Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT8A9DM)

• DTT Name: Complement C1q component (C1Q)
• Synonyms: C1QB
• Gene Name: C1QB
• DTT Type: Literature-reported target; [1]
• UniProt ID: C1QB_HUMAN
• TTD ID: T43793
• Sequence:
  MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKG
  EKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQ
  KIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNL
  CVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANS
  IFSGFLLFPDMEA
• Function: C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takesplace on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
• KEGG Pathway:
  Complement and coagulation cascades (hsa04610)
  Alcoholic liver disease (hsa04936)
  Prion disease (hsa05020)
  Pertussis (hsa05133)
  Chagas disease (hsa05142)
  Staphylococcus aureus infection (hsa05150)
  Coronavirus disease - COVID-19 (hsa05171)
  Systemic lupus erythematosus (hsa05322)
• Reactome Pathway:
  Classical antibody-mediated complement activation (R-HSA-173623)
  Regulation of Complement cascade (R-HSA-977606)
  Initial triggering of complement (R-HSA-166663)

References

• [1] Interaction between complement subcomponent C1q and the Klebsiella pneumoniae porin OmpK36. Infect Immun. 1996 Nov;64(11):4719-25.