Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT8COJM)
| DTT Name | Suppressor of cytokine signaling 1 (SOCS1) | ||||
|---|---|---|---|---|---|
| Synonyms | Tec-interacting protein 3; TIP3; TIP-3; STAT-induced STAT inhibitor 1; STAT induced STAT inhibitor 1; SSI1; SSI-1; SOCS-1; JAK-binding protein; JAB | ||||
| Gene Name | SOCS1 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRS
HADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMA SGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQ RIVATVGRENLARIPLNPVLRDYLSSFPFQI |
||||
| Function |
SOCS1 is involved in negative regulation of cytokines that signal through the JAK/STAT3 pathway. Through binding to JAKs, inhibits their kinase activity. In vitro, also suppresses Tec protein-tyrosine activity. Appears to be a major regulator of signaling by interleukin 6 (IL6) and leukemia inhibitory factor (LIF). Regulates interferon-gamma mediated sensory neuron survival. Probable substrate recognition component of an ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Seems to recognize JAK2. SOCS1 appears to be a negative regulator in IGF1R signaling pathway. SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction.
|
||||
| KEGG Pathway |
|
||||
| Reactome Pathway |
|
||||