Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT8CWJG)
DTT Name | Alpha-crystallin A chain (CRYAA) | ||||
---|---|---|---|---|---|
Synonyms | HspB4; Heat shock protein beta-4; CRYA1 | ||||
Gene Name | CRYAA | ||||
DTT Type |
Literature-reported target
|
[1] | |||
BioChemical Class |
Heat shock protein
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSG
ISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRL PSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS |
||||
Function | Has chaperone-like activity, preventing aggregation of various proteins under a wide range of stress conditions. Contributes to the transparency and refractive index of the lens. | ||||
KEGG Pathway | |||||