Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT8D13I)

• DTT Name: Complement factor D (CFD)
• Synonyms: Properdin factor D; PFD; DF; C3 convertase activator; Adipsin
• Gene Name: CFD
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Peptidase
• UniProt ID: CFAD_HUMAN
• TTD ID: T66383
• EC Number: EC 3.4.21.46
• Sequence:
  MHSWERLAVLVLLGAAACAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQW
  VLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQL
  SEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCN
  RRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTR
  VASYAAWIDSVLA
• Function: Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Its function is homologous to that of C1s in the classical pathway.
• KEGG Pathway:
  Complement and coagulation cascades (hsa04610)
  Staphylococcus aureus infection (hsa05150)
• Reactome Pathway:
  Alternative complement activation (R-HSA-173736)
  Platelet degranulation (R-HSA-114608)

Molecular Interaction Atlas (MIA) of This DTT

7 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ALXN2040	DMLJ18Y	Paroxysmal nocturnal haemoglobinuria	3A21.0	Phase 3	[2]
Lampalizumab	DMA2NYS	Geographic retinal atrophy	9B78.9	Phase 3	[3]
ACH-4471	DMLVCZR	Anaemia	3A90	Phase 2	[4]
BCX-9930	DMBNC1I	Paroxysmal nocturnal haemoglobinuria	3A21.0	Phase 2	[5]
Vemircopan	DM3RZ9H	Generalized myasthenia gravis	8C60	Phase 2	[6]
Anti-Factor D	DM8ENKS	Age-related macular degeneration	9B75.0	Phase 1/2	[1]
ALXN2080	DMQPZQB	Discovery agent	N.A.	Phase 1	[7]

2 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
example 373 [WO2012093101]	DMP8A5R	Discovery agent	N.A.	Investigative	[8]
HC3-1496	DM1BLCX	Autoimmune diabetes	5A10	Investigative	[9]

References

• [1] Association for Research in Vision and Ophthalmology (ARVO)--2010 Annual Meeting. For Sight: The Future of Eye and Vision Research--part 1. IDrugs. 2010 Jul;13(7):427-9.
• [2] Danicopan: an oral complement factor D inhibitor for paroxysmal nocturnal hemoglobinuria. Haematologica. 2021 Dec 1;106(12):3188-3197.
• [3] In Vivo Stability Profiles of Anti-factor D Molecules Support Long-Acting Delivery Approaches. Mol Pharm. 2019 Jan 7;16(1):86-95.
• [4] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [5] ClinicalTrials.gov (NCT05116774) A Randomized, Open-Label, Multicenter, Parallel-Group Study to Evaluate the Efficacy, Safety, and Tolerability of Oral BCX9930 Monotherapy for the Treatment of PNH in Subjects With Inadequate Response to C5 Inhibitor Therapy. U.S.National Institutes of Health.
• [6] Clinical pipeline report, company report or official report of AstraZeneca
• [7] Clinical pipeline report, company report or official report of Alexion
• [8] Factor D Inhibitors for the Treatment of AMD: Patent Highlight. ACS Med Chem Lett. 2012 Aug 27;3(10):781-2.
• [9] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2842).