Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT8K17W)

• DTT Name: Histone deacetylase 11 (HDAC11)
• Synonyms: HD11
• Gene Name: HDAC11
• DTT Type: Patented-recorded target; [1]
• BioChemical Class: Carbon-nitrogen hydrolase
• UniProt ID: HDA11_HUMAN
• TTD ID: T97903
• EC Number: EC 3.5.1.98
• Sequence:
  MLHTTQLYQHVPETRWPIVYSPRYNITFMGLEKLHPFDAGKWGKVINFLKEEKLLSDSML
  VEAREASEEDLLVVHTRRYLNELKWSFAVATITEIPPVIFLPNFLVQRKVLRPLRTQTGG
  TIMAGKLAVERGWAINVGGGFHHCSSDRGGGFCAYADITLAIKFLFERVEGISRATIIDL
  DAHQGNGHERDFMDDKRVYIMDVYNRHIYPGDRFAKQAIRRKVELEWGTEDDEYLDKVER
  NIKKSLQEHLPDVVVYNAGTDILEGDRLGGLSISPAGIVKRDELVFRMVRGRRVPILMVT
  SGGYQKRTARIIADSILNLFGLGLIGPESPSVSAQNSDTPLLPPAVP
• Function: Gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4).
• Reactome Pathway:
  Constitutive Signaling by NOTCH1 PEST Domain Mutants (R-HSA-2644606)
  Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants (R-HSA-2894862)
  Notch-HLH transcription pathway (R-HSA-350054)
  NOTCH1 Intracellular Domain Regulates Transcription (R-HSA-2122947)

Molecular Interaction Atlas (MIA) of This DTT

7 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
PMID29671355-Compound-21	DMPJN0M	N. A.	N. A.	Patented	[1]
PMID29671355-Compound-23	DMUBOEX	N. A.	N. A.	Patented	[1]
PMID29671355-Compound-25	DMPV0KZ	N. A.	N. A.	Patented	[1]
PMID29671355-Compound-36	DMQJ3TC	N. A.	N. A.	Patented	[1]
PMID29671355-Compound-43	DMVPMWJ	N. A.	N. A.	Patented	[1]
PMID29671355-Compound-44	DM80A3V	N. A.	N. A.	Patented	[1]
PMID29671355-Compound-62	DMWRS34	N. A.	N. A.	Patented	[1]

References

• [1] HDAC inhibitors: a 2013-2017 patent survey.Expert Opin Ther Pat. 2018 Apr 19:1-17.