Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT8Z1FE)
DTT Name | Human immunodeficiency virus Tat-TAR RNA interaction (HIV Tat-TAR PPI) | ||||
---|---|---|---|---|---|
Synonyms | HIV Protein Tat-TAR RNA interaction | ||||
Gene Name | HIV Tat-TAR PPI | ||||
DTT Type |
Literature-reported target
|
[1] | |||
UniProt ID | |||||
TTD ID | |||||
Sequence |
MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRAHQ
NSQTHQASLSKQPTSQPRGDPTGPKE |
||||
Function | Inhibit Tat-dependent transcription of HIV DNA. | ||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||