Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT8Z1OP)

• DTT Name: Human immunodeficiency virus Nucleocapsid p7 (HIV p7)
• Synonyms: HIV NC
• Gene Name: HIV p7
• DTT Type: Clinical trial target; [1]
• UniProt ID: POL_HV1B1
• TTD ID: T15107
• Sequence: MQRGNFRNQRKMVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQAN
• Function: Gag-Pol polyprotein: Mediates, with Gag polyprotein, the essential events in virion assembly, including binding the plasma membrane, making the protein-protein interactions necessary to create spherical particles, recruiting the viral Env proteins, and packaging the genomic RNA via direct interactions with the RNA packaging sequence (Psi). Gag-Pol polyprotein may regulate its own translation, by the binding genomic RNA in the 5'-UTR. At low concentration, the polyprotein would promote translation, whereas at high concentration, the polyprotein would encapsidate genomic RNA and then shut off translation.

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
HPH-116	DM3WSL2	Human immunodeficiency virus infection	1C62	Phase 2	[1]

References

• [1] Clinical pipeline report, company report or official report of H-Phar.