Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT90CMU)
DTT Name | Cholecystokinin (CCK) | ||||
---|---|---|---|---|---|
Synonyms | Procholecystokinin; CCK | ||||
Gene Name | CCK | ||||
DTT Type |
Literature-reported target
|
[1] | |||
BioChemical Class |
Gastrin cholecystokinin
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGA
LLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS |
||||
Function |
This peptide hormone induces gall bladder contraction and therelease of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion.
|
||||
KEGG Pathway | |||||
Reactome Pathway | |||||