Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT958S6)
DTT Name | Ras-related protein Rab-9A (RAB9A) | ||||
---|---|---|---|---|---|
Synonyms | RAB9A | ||||
Gene Name | RAB9A | ||||
DTT Type |
Successful target
|
[1] | |||
BioChemical Class |
Small GTPase superfamily
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MAGKSSLFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQI
WDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFV ILGNKIDISERQVSTEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLATEDRSD HLIQTDTVNLHRKPKPSSSCC |
||||
Function | Involved in the transport of proteins between the endosomes and the trans Golgi network. | ||||
KEGG Pathway | |||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Approved Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
1 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||