Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT95ICL)

• DTT Name: Mannose-6-phosphate receptor (M6PR)
• Synonyms: MPRD; MPR46; MPR 46; Cation-dependent mannose-6-phosphate receptor; CDMan-6-P receptor; CD-MPR; CD Man-6-P receptor; 46kDa mannose 6-phosphate receptor; 46 kDa mannose 6-phosphate receptor
• Gene Name: M6PR
• DTT Type: Successful target; [1]
• BioChemical Class: Mannose 6-phosphate receptor
• UniProt ID: MPRD_HUMAN
• TTD ID: T97174
• Sequence:
  MFPFYSCWRTGLLLLLLAVAVRESWQTEEKTCDLVGEKGKESEKELALVKRLKPLFNKSF
  ESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKETVVGRLNETHIFNGSNWIML
  IYKGGDEYDNHCGKEQRRAVVMISCNRHTLADNFNPVSEERGKVQDCFYLFEMDSSLACS
  PEISHLSVGSILLVTFASLVAVYVVGGFLYQRLVVGAKGMEQFPHLAFWQDLGNLVADGC
  DFVCRSKPRNVPAAYRGVGDDQLGEESEERDDHLLPM
• Function: Lysosomal enzymes bearing phosphomannosyl residues bind specifically to mannose-6-phosphate receptors in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelyosomal compartment where the low pH mediates the dissociation of the complex. Transport of phosphorylated lysosomal enzymes from the Golgi complex and the cell surface to lysosomes.
• KEGG Pathway:
  Lysosome (hsa04142)
  Phagosome (hsa04145)
• Reactome Pathway: Lysosome Vesicle Biogenesis (R-HSA-432720)

Molecular Interaction Atlas (MIA) of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Alglucosidase alfa	DM4LOD0	Pompe disease	5C51.3	Approved	[1]

2 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
1-3 Sugar Ring of Pentamannosyl 6-Phosphate	DMRO1IU	Discovery agent	N.A.	Investigative	[2]
Alpha-D-Mannose-6-Phosphate	DM3NCM1	Discovery agent	N.A.	Investigative	[2]

References

• [1] Early treatment with alglucosidase alpha prolongs long-term survival of infants with Pompe disease. Pediatr Res. 2009 Sep;66(3):329-35.
• [2] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.