Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT9721Y)

• DTT Name: Interleukin 2 receptor beta (IL2RB)
• Synonyms: P70-75; Interleukin-2 receptor subunit beta; Interleukin-15 receptor subunit beta; IL15RB; IL-2RB; IL-2R subunit beta; IL-2 receptor subunit beta; IL-2 receptor; High affinity IL-2 receptor subunit beta; CD122
• Gene Name: IL2RB
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Cytokine receptor
• UniProt ID: IL2RB_HUMAN
• TTD ID: T19579
• Sequence:
  MAAPALSWRLPLLILLLPLATSWASAAVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQ
  VHAWPDRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMA
  IQDFKPFENLRLMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGHTWEE
  APLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQPLAFRTKPAALGKDT
  IPWLGHLLVGLSGAFGFIILVYLLINCRNTGPWLKKVLKCNTPDPSKFFSQLSSEHGGDV
  QKWLSSPFPSSSFSPGGLAPEISPLEVLERDKVTQLLLQQDKVPEPASLSSNHSLTSCFT
  NQGYFFFHLPDALEIEACQVYFTYDPYSEEDPDEGVAGAPTGSSPQPLQPLSGEDDAYCT
  FPSRDDLLLFSPSLLGGPSPPSTAPGGSGAGEERMPPSLQERVPRDWDPQPLGPPTPGVP
  DLVDFQPPPELVLREAGEEVPDAGPREGVSFPWSRPPGQGEFRALNARLPLNTDAYLSLQ
  ELQGQDPTHLV
• Function: Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2. Probably in association with IL15RA, involved in the stimulation of neutrophil phagocytosis by IL15.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Endocytosis (hsa04144)
  PI3K-Akt signaling pathway (hsa04151)
  Jak-STAT signaling pathway (hsa04630)
  Measles (hsa05162)
  HTLV-I infection (hsa05166)
  Transcriptional misregulation in cancer (hsa05202)
• Reactome Pathway:
  G beta (R-HSA-392451)
  Interleukin-2 signaling (R-HSA-451927)
  RAF/MAP kinase cascade (R-HSA-5673001)
  Interleukin receptor SHC signaling (R-HSA-912526)
  GPVI-mediated activation cascade (R-HSA-114604)

Molecular Interaction Atlas (MIA) of This DTT

4 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
NKTR 214	DM376WT	Melanoma	2C30	Phase 3	[2]
NKTR-214	DMACYW6	Melanoma	2C30	Phase 3	[3]
AFTVac	DMD3XMG	Glioblastoma multiforme	2A00.0	Phase 2	[1]
Leukocyte interleukin	DM2B0TJ	Head and neck cancer	2D42	Phase 1	[4]

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
DAB-486-IL-2	DM54T8J	Discovery agent	N.A.	Investigative	[5]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Glioma	2C82	Brainstem tissue	7.52E-01	-0.06	-1.11
Glioma	2C82	White matter	1.96E-01	-4.70E-03	-0.01

References

• [1] Phase II randomized trial of autologous formalin-fixed tumor vaccine for postsurgical recurrence of hepatocellular carcinoma. Clin Cancer Res. 2004 Mar 1;10(5):1574-9.
• [2] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [3] Bempegaldesleukin selectively depletes intratumoral Tregs and potentiates T cell-mediated cancer therapy. Nat Commun. 2020 Jan 31;11(1):661.
• [4] Leukocyte Interleukin, Inj. (LI) augmentation of natural killer cells and cytolytic T-lymphocytes. Immunopharmacol Immunotoxicol. 1995 May;17(2):247-64.
• [5] Interleukin 2 receptor targeted fusion toxin (DAB486-IL-2) treatment blocks diabetogenic autoimmunity in non-obese diabetic mice. Eur J Immunol. 1992 Mar;22(3):697-702.