Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT975ZT)

DTT Name	Ferritin (FTH1)
Synonyms	PIG15; OK/SW-cl.84; Ferritin heavy chain; Ferritin H subunit; FTHL6; FTH; Cell proliferationinducing gene 15 protein; Cell proliferation-inducing gene 15 protein
Gene Name	FTH1
DTT Type	Clinical trial target	[1]
BioChemical Class	Metal ion oxidoreductase
UniProt ID	FRIH_HUMAN
TTD ID	T89873
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	EC 1.16.3.1
Sequence	MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQS HEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHK LATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSD NES
Function	Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation. Also plays a role in delivery of iron to cells. Mediates iron uptake in capsule cells of the developing kidney. Stores iron in a soluble, non-toxic, readily available form.
KEGG Pathway	Mineral absorption (hsa04978 )
Reactome Pathway	Golgi Associated Vesicle Biogenesis (R-HSA-432722 ) Iron uptake and transport (R-HSA-917937 ) Scavenging by Class A Receptors (R-HSA-3000480 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Ferritarg P	DMRHOFB	Lymphoma	2A80-2A86	Phase 1/2	[1]
------------------------------------------------------------------------------------

References

1	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800019964)