| DTT Name |
Melanoma differentiation-associated protein 6 (CDKN1A)
|
| Synonyms |
WAF1; SDI1; PIC1; P21(WAF1); P21; Melanoma differentiation associated protein 6; MDA6; MDA-6; Cyclin-dependent kinase inhibitor 1; CIP1; CDK-interacting protein 1; CAP20 |
| Gene Name |
CDKN1A
|
| DTT Type |
Literature-reported target
|
[1] |
| UniProt ID |
|
| TTD ID |
|
| 3D Structure |
|
| Sequence |
MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLV
PRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
|
| Function |
Binds to and inhibits cyclin-dependent kinase activity, preventing phosphorylation of critical cyclin-dependent kinase substrates and blocking cell cycle progression. Functions in the nuclear localization and assembly of cyclin D-CDK4 complex and promotes its kinase activity towards RB1. At higher stoichiometric ratios, inhibits the kinase activity of the cyclin D-CDK4 complex. Inhibits DNA synthesis by DNA polymerase delta by competing with POLD3 for PCNA binding. May be involved in p53/TP53 mediated inhibition of cellular proliferation in response to DNA damage.
|
| KEGG Pathway |
- Endocrine resistance (hsa01522 )
- Platinum drug resistance (hsa01524 )
- ErbB signaling pathway (hsa04012 )
- HIF-1 signaling pathway (hsa04066 )
- FoxO signaling pathway (hsa04068 )
- Cell cycle (hsa04110 )
- p53 signaling pathway (hsa04115 )
- PI3K-Akt signaling pathway (hsa04151 )
- Cellular senescence (hsa04218 )
- JAK-STAT signaling pathway (hsa04630 )
- Oxytocin signaling pathway (hsa04921 )
- Parathyroid hormone synthesis, secretion and action (hsa04928 )
- Cushing syndrome (hsa04934 )
- Hepatitis C (hsa05160 )
- Hepatitis B (hsa05161 )
- Human cytomegalovirus infection (hsa05163 )
- Human papillomavirus infection (hsa05165 )
- Human T-cell leukemia virus 1 infection (hsa05166 )
- Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
- Epstein-Barr virus infection (hsa05169 )
- Pathways in cancer (hsa05200 )
- Transcriptional misregulation in cancer (hsa05202 )
- Viral carcinogenesis (hsa05203 )
- Proteoglycans in cancer (hsa05205 )
- MicroRNAs in cancer (hsa05206 )
- Colorectal cancer (hsa05210 )
- Renal cell carcinoma (hsa05211 )
- Pancreatic cancer (hsa05212 )
- Endometrial cancer (hsa05213 )
- Glioma (hsa05214 )
- Prostate cancer (hsa05215 )
- Thyroid cancer (hsa05216 )
- Basal cell carcinoma (hsa05217 )
- Melanoma (hsa05218 )
- Bladder cancer (hsa05219 )
- Chronic myeloid leukemia (hsa05220 )
- Small cell lung cancer (hsa05222 )
- Non-small cell lung cancer (hsa05223 )
- Breast cancer (hsa05224 )
- Hepatocellular carcinoma (hsa05225 )
- Gastric cancer (hsa05226 )
|
| Reactome Pathway |
- AKT phosphorylates targets in the cytosol (R-HSA-198323 )
- Senescence-Associated Secretory Phenotype (SASP) (R-HSA-2559582 )
- DNA Damage/Telomere Stress Induced Senescence (R-HSA-2559586 )
- Constitutive Signaling by AKT1 E17K in Cancer (R-HSA-5674400 )
- Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807 )
- TP53 Regulates Transcription of Genes Involved in G1 Cell Cycle Arrest (R-HSA-6804116 )
- Cyclin E associated events during G1/S transition (R-HSA-69202 )
- Cyclin D associated events in G1 (R-HSA-69231 )
- p53-Dependent G1 DNA Damage Response (R-HSA-69563 )
- Cyclin A (R-HSA-69656 )
- Transcriptional activation of cell cycle inhibitor p21 (R-HSA-69895 )
- The role of GTSE1 in G2/M progression after G2 checkpoint (R-HSA-8852276 )
- TFAP2 (AP-2) family regulates transcription of cell cycle factors (R-HSA-8866911 )
- Transcriptional regulation by RUNX2 (R-HSA-8878166 )
- RUNX3 regulates CDKN1A transcription (R-HSA-8941855 )
- Transcriptional regulation of granulopoiesis (R-HSA-9616222 )
- FOXO-mediated transcription of cell cycle genes (R-HSA-9617828 )
- Defective binding of RB1 mutants to E2F1,(E2F2, E2F3) (R-HSA-9661069 )
- STAT5 activation downstream of FLT3 ITD mutants (R-HSA-9702518 )
- Signaling by FLT3 fusion proteins (R-HSA-9703465 )
- SCF(Skp2)-mediated degradation of p27/p21 (R-HSA-187577 )
|
|
|
|
|
|
|
