Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT9OUDQ)

• DTT Name: p53-binding protein Mdm4 (MDM4)
• Synonyms: Protein Mdmx; Mdm2-like p53-binding protein; Double minute 4 protein
• Gene Name: MDM4
• DTT Type: Clinical trial target; [1]
• BioChemical Class: MDM2/MDM4 family
• UniProt ID: MDM4_HUMAN
• TTD ID: T36741
• Sequence:
  MTSFSTSAQCSTSDSACRISPGQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYI
  MVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLATATTDAAQTL
  ALAQDHSMDIPSQDQLKQSAEESSTSRKRTTEDDIPTLPTSEHKCIHSREDEDLIENLAQ
  DETSRLDLGFEEWDVAGLPWWFLGNLRSNYTPRSNGSTDLQTNQDVGTAIVSDTTDDLWF
  LNESVSEQLGVGIKVEAADTEQTSEEVGKVSDKKVIEVGKNDDLEDSKSLSDDTDVEVTS
  EDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSDITAIPEKENEGNDVP
  DCRRTISAPVVRPKDAYIKKENSKLFDPCNSVEFLDLAHSSESQETISSMGEQLDNLSEQ
  RTDTENMEDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKE
  IQLVIKVFIA
• Function: Inhibits p53/TP53- and TP73/p73-mediated cell cycle arrest and apoptosis by binding its transcriptional activation domain. Inhibits degradation of MDM2. Can reverse MDM2-targeted degradation of TP53 while maintaining suppression of TP53 transactivation and apoptotic functions.
• KEGG Pathway:
  p53 signaling pathway (hsa04115)
  MicroRNAs in cancer (hsa05206)
• Reactome Pathway:
  Oncogene Induced Senescence (R-HSA-2559585)
  Ub-specific processing proteases (R-HSA-5689880)
  Regulation of TP53 Activity through Phosphorylation (R-HSA-6804756)
  Regulation of TP53 Degradation (R-HSA-6804757)
  Regulation of TP53 Activity through Methylation (R-HSA-6804760)
  Stabilization of p53 (R-HSA-69541)
  Oxidative Stress Induced Senescence (R-HSA-2559580)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ALRN-6924	DMLBWT1	Haematological malignancy	2B33.Y	Phase 2	[1]

1 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
NSC-207895	DMO5MUY	Solid tumour/cancer	2A00-2F9Z	Preclinical	[2]

References

• [1] Anti-ageing pipeline starts to mature.Nat Rev Drug Discov. 2018 Sep;17(9):609-612.
• [2] Emerging therapies targeting the ubiquitin proteasome system in cancer. J Clin Invest. 2014 Jan;124(1):6-12.