Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT9QEJ6)

• DTT Name: Interleukin-21 (IL21)
• Synonyms: Za11; Interleukin21; IL-21
• Gene Name: IL21
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Cytokine: interleukin
• UniProt ID: IL21_HUMAN
• TTD ID: T51223
• Sequence:
  MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEF
  LPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRL
  TCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
• Function: May promote the transition between innate and adaptive immunity. Induces the production of IgG(1) and IgG(3) in B-cells. May play a role in proliferation and maturation of natural killer (NK) cells in synergy with IL15. May regulate proliferation of mature B- and T-cells in response to activating stimuli. In synergy with IL15 and IL18 stimulates interferon gamma production in T-cells and NK cells. During T-cell mediated immune response may inhibit dendritic cells (DC) activation and maturation. Cytokine with immunoregulatory activity.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Jak-STAT signaling pathway (hsa04630)
  Inflammatory bowel disease (IBD) (hsa05321)
• Reactome Pathway: Interleukin-21 signaling (R-HSA-9020958)

Molecular Interaction Atlas (MIA) of This DTT

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
IL-21	DM1E4VP	Colorectal cancer	2B91.Z	Phase 2	[1]
NN-8828	DMYXDB9	Autoimmune diabetes	5A10	Phase 1	[2]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Rectal cancer	2C82	Rectal colon tissue	2.92E-02	0.09	1.42

References

• [1] National Cancer Institute Drug Dictionary (drug id 409696).
• [2] Handbook of Therapeutic Antibodies. 2014. 1. Page(995).