Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT9T4AV)

• DTT Name: Prostate stem cell antigen (PSCA)
• Synonyms: UNQ206/PRO232
• Gene Name: PSCA
• DTT Type: Clinical trial target; [1]
• UniProt ID: PSCA_HUMAN
• TTD ID: T23953
• Sequence:
  MAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLN
  CVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL
• Function: Has a cell-proliferation inhibition activity in vitro. May be involved in the regulation of cell proliferation.
• Reactome Pathway: Post-translational modification (R-HSA-163125)

Molecular Interaction Atlas (MIA) of This DTT

5 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Anti-PSCA mab	DMJPZDC	Pancreatic cancer	2C10	Phase 2	[1]
BPX-601	DMV9QGW	Gastric adenocarcinoma	2B72	Phase 1/2	[2]
CAR-T cells targeting PSCA	DMU4G9J	Pancreatic cancer	2C10	Phase 1	[3]
GEM3PSCA	DM3GSPR	Non-small-cell lung cancer	2C25	Phase 1	[4]
MB-105	DMVGTP6	Prostate cancer	2C82.0	Phase 1	[5]

References

• [1] Phase I rapid dose-escalation study of AGS-1C4D4, a human anti-PSCA (prostate stem cell antigen) monoclonal antibody, in patients with castration-resistant prostate cancer: a PCCTC trial. Cancer Chemother Pharmacol. 2012 Mar;69(3):763-71.
• [2] ClinicalTrials.gov (NCT02744287) Use of Ligand-Inducible Autologous T Cells Engineered to Target PSCA on Tumor Cells in Selected Advanced Solid Tumors
• [3] ClinicalTrials.gov (NCT03267173) Evaluate the Safety and Efficacy of CAR-T in the Treatment of Pancreatic Cancer.
• [4] Clinical pipeline report, company report or official report of Gemoab.
• [5] Clinical pipeline report, company report or official report of Mustang Bio.