Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTA7YIZ)
DTT Name | Corticoliberin (CRH) | ||||
---|---|---|---|---|---|
Synonyms | Corticotropin-releasing hormone; Corticotropin-releasing factor; Corticotropin releasing hormone; Corticotropin; CRF; Adrenocorticotropic hormone | ||||
Gene Name | CRH | ||||
DTT Type |
Literature-reported target
|
[1] | |||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MRLPLLVSAGVLLVALLPCPPCRALLSRGPVPGARQAPQHPQPLDFFQPPPQSEQPQQPQ
ARPVLLRMGEEYFLRLGNLNKSPAAPLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLL LPRRSLDSPAALAERGARNALGGHQEAPERERRSEEPPISLDLTFHLLREVLEMARAEQL AQQAHSNRKLMEIIGK |
||||
Function | Induces NLRP6 in intestinal epithelial cells, hence may influence gut microbiota profile. Hormone regulating the release of corticotropin from pituitary gland. | ||||
KEGG Pathway | |||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
2 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||