Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTA8GFO)
| DTT Name | Protein tyrosine phosphatase IVA 1 (PRL-1) | ||||
|---|---|---|---|---|---|
| Synonyms | Protein-tyrosine phosphatase of regenerating liver 1; Protein-tyrosine phosphatase 4a1; Protein tyrosine phosphatase type IVA 1; PTPCAAX1; PTP(CAAXI); PRL1 | ||||
| Gene Name | PTP4A1 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Phosphoric monoester hydrolase
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| EC Number |
EC 3.1.3.48
|
||||
| Sequence |
MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEK
EGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALI EGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ |
||||
| Function |
May play a role in the development and maintenance of differentiating epithelial tissues. Enhances cell proliferation, cell motility and invasive activity, and promotes cancer metastasis. Protein tyrosine phosphatase which stimulates progression from G1 into S phase during mitosis.
|
||||