Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTAJ746)
| DTT Name | Ras-related protein Rab-22A (Rab22a) | ||||
|---|---|---|---|---|---|
| Synonyms | Rab-22; RAB22 | ||||
| Gene Name | RAB22A | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Small GTPase
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWD
TAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVKELRQHGPPNIVVAIAGNKC DLIDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDANLPSGGKGF KLRRQPSEPKRSCC |
||||
| Function |
Mediates trafficking of TF from early endosomes to recycling endosomes. Required for NGF-mediated endocytosis of NTRK1, and subsequent neurite outgrowth. Binds GTP and GDP and has low GTPase activity. Alternates between a GTP-bound active form and a GDP-bound inactive form. Plays a role in endocytosis and intracellular protein transport.
|
||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||