Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTAMKGB)

• DTT Name: Voltage-dependent anion-selective channel 1 (VDAC1)
• Synonyms: Porin 31HM; Porin 31HL; Plasmalemmal porin; Outer mitochondrial membrane protein porin 1
• Gene Name: VDAC1
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Eukaryotic mitochondrial porin
• UniProt ID: VDAC1_HUMAN
• TTD ID: T99397
• Sequence:
  MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLET
  KYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKR
  EHINLGCDMDFDIAGPSIRGALVLGYEGWLAGYQMNFETAKSRVTQSNFAVGYKTDEFQL
  HTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQIDPDACFSAKVNNS
  SLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
• Function: Forms a channel through the mitochondrial outer membrane and also the plasma membrane. The channel at the outer mitochondrial membrane allows diffusion of small hydrophilic molecules; in the plasma membrane it is involved in cell volume regulation and apoptosis. It adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective (PubMed:11845315, PubMed:18755977, PubMed:20230784, PubMed:8420959). May participate in the formation of the permeability transition pore complex (PTPC) responsible for the release of mitochondrial products that triggers apoptosis (PubMed:15033708, PubMed:25296756).
• KEGG Pathway:
  Calcium signaling pathway (hsa04020)
  cGMP-PKG signaling pathway (hsa04022)
  Necroptosis (hsa04217)
  Cellular senescence (hsa04218)
  NOD-like receptor signaling pathway (hsa04621)
  Cholesterol metabolism (hsa04979)
  Parkinson disease (hsa05012)
  Huntington disease (hsa05016)
  Influenza A (hsa05164)
  Human T-cell leukemia virus 1 infection (hsa05166)
• Reactome Pathway:
  PINK1-PRKN Mediated Mitophagy (R-HSA-5205685)
  Ub-specific processing proteases (R-HSA-5689880)
  Pyruvate metabolism (R-HSA-70268)
  Mitochondrial calcium ion transport (R-HSA-8949215)
  Mitochondrial protein import (R-HSA-1268020)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
VDA-1102	DMAJ85O	Actinic keratosis	EK90.0	Phase 2	[1]

References

• [1] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)