Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTASI04)

DTT Name	E2F1 messenger RNA (E2F1 mRNA)
Synonyms	pRB-binding protein E2F-1 (mRNA); Transcription factor E2F1 (mRNA); Retinoblastoma-binding protein 3 (mRNA); Retinoblastoma-associated protein 1 (mRNA); RBBP3 (mRNA); RBBP-3 (mRNA); RBAP-1 (mRNA); PBR3 (mRNA); E2F-1 (mRNA)
Gene Name	E2F1
DTT Type	Literature-reported target	[1]
BioChemical Class	mRNA target
UniProt ID	E2F1_HUMAN
TTD ID	T28729
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCD PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVK SPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLI AKKSKNHIQWLGSHTTVGVGGRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDS QRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSENFQISLKSKQGPIDVFLCPE ETVGGISPGKTPSQEVTSEEENRATDSATIVSPPPSSPPSSLTTDPSQSLLSLEQEPLLS RMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEG IRDLFDCDFGDLTPLDF
Function	The DRTF1/E2F complex functions in the control of cell-cycle progression from G1 to S phase. E2F1 binds preferentially RB1 in a cell-cycle dependent manner. It can mediate both cell proliferation and TP53/p53-dependent apoptosis. Blocks adipocyte differentiation by binding to specific promoters repressing CEBPA binding to its target gene promoters. Positively regulates transcription of RRP1B. Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication.
KEGG Pathway	Cell cycle (hsa04110 ) Hepatitis B (hsa05161 ) HTLV-I infection (hsa05166 ) Pathways in cancer (hsa05200 ) MicroRNAs in cancer (hsa05206 ) Pancreatic cancer (hsa05212 ) Glioma (hsa05214 ) Prostate cancer (hsa05215 ) Melanoma (hsa05218 ) Bladder cancer (hsa05219 ) Chronic myeloid leukemia (hsa05220 ) Small cell lung cancer (hsa05222 ) Non-small cell lung cancer (hsa05223 )
Reactome Pathway	E2F mediated regulation of DNA replication (R-HSA-113510 ) Activation of PUMA and translocation to mitochondria (R-HSA-139915 ) G0 and Early G1 (R-HSA-1538133 ) Pre-NOTCH Transcription and Translation (R-HSA-1912408 ) Oxidative Stress Induced Senescence (R-HSA-2559580 ) Oncogene Induced Senescence (R-HSA-2559585 ) CDC6 association with the ORC (R-HSA-68689 ) G2 Phase (R-HSA-68911 ) G1/S-Specific Transcription (R-HSA-69205 ) Cyclin D associated events in G1 (R-HSA-69231 ) Association of licensing factors with the pre-replicative complex (R-HSA-69298 ) Activation of NOXA and translocation to mitochondria (R-HSA-111448 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DTT

5 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ISIS 113019	DMVCYBG	Discovery agent	N.A.	Investigative	[1]
ISIS 113020	DMUXN8P	Discovery agent	N.A.	Investigative	[1]
ISIS 113021	DMQ4GL6	Discovery agent	N.A.	Investigative	[1]
ISIS 113022	DMOQ0XD	Discovery agent	N.A.	Investigative	[1]
ISIS 113048	DMKTNVJ	Discovery agent	N.A.	Investigative	[1]
------------------------------------------------------------------------------------

References

1	US patent application no. 6,187,587, Antisense inhibition of e2f transcription factor 1 expression.