DTT Name |
GTPase KRas (KRAS)
|
Synonyms |
c-Ki-ras; c-K-ras; RASK2; Ki-Ras; KRAS2; K-Ras 2 |
Gene Name |
KRAS
|
DTT Type |
Clinical trial target
|
[1] |
BioChemical Class |
Small GTPase
|
UniProt ID |
|
TTD ID |
|
3D Structure |
|
Sequence |
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC VKIKKCIIM
|
Function |
Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the regulation of cell proliferation. Plays a role in promoting oncogenic events by inducing transcriptional silencing of tumor suppressor genes (TSGs) in colorectal cancer (CRC) cells in a ZNF304-dependent manner.
|
KEGG Pathway |
- EGFR tyrosine kinase inhibitor resistance (hsa01521 )
- Endocrine resistance (hsa01522 )
- MAPK signaling pathway (hsa04010 )
- ErbB signaling pathway (hsa04012 )
- Ras signaling pathway (hsa04014 )
- Rap1 signaling pathway (hsa04015 )
- Chemokine signaling pathway (hsa04062 )
- FoxO signaling pathway (hsa04068 )
- Sphingolipid signaling pathway (hsa04071 )
- Phospholipase D signaling pathway (hsa04072 )
- Mitophagy - animal (hsa04137 )
- Autophagy - animal (hsa04140 )
- mTOR signaling pathway (hsa04150 )
- PI3K-Akt signaling pathway (hsa04151 )
- Apoptosis (hsa04210 )
- Longevity regulating pathway (hsa04211 )
- Longevity regulating pathway - multiple species (hsa04213 )
- Cellular senescence (hsa04218 )
- Axon guidance (hsa04360 )
- VEGF signaling pathway (hsa04370 )
- Apelin signaling pathway (hsa04371 )
- Gap junction (hsa04540 )
- Signaling pathways regulating pluripotency of stem cells (hsa04550 )
- C-type lectin receptor signaling pathway (hsa04625 )
- Natural killer cell mediated cytotoxicity (hsa04650 )
- T cell receptor signaling pathway (hsa04660 )
- B cell receptor signaling pathway (hsa04662 )
- Fc epsilon RI signaling pathway (hsa04664 )
- Thermogenesis (hsa04714 )
- Long-term potentiation (hsa04720 )
- Neurotrophin signaling pathway (hsa04722 )
- Cholinergic synapse (hsa04725 )
- Serotonergic synapse (hsa04726 )
- Long-term depression (hsa04730 )
- Regulation of actin cytoskeleton (hsa04810 )
- Insulin signaling pathway (hsa04910 )
- GnRH signaling pathway (hsa04912 )
- Progesterone-mediated oocyte maturation (hsa04914 )
- Estrogen signaling pathway (hsa04915 )
- Melanogenesis (hsa04916 )
- Prolactin signaling pathway (hsa04917 )
- Thyroid hormone signaling pathway (hsa04919 )
- Oxytocin signaling pathway (hsa04921 )
- Relaxin signaling pathway (hsa04926 )
- AGE-RAGE signaling pathway in diabetic complications (hsa04933 )
- Aldosterone-regulated sodium reabsorption (hsa04960 )
- Alcoholism (hsa05034 )
- Hepatitis C (hsa05160 )
- Hepatitis B (hsa05161 )
- Human cytomegalovirus infection (hsa05163 )
- Human papillomavirus infection (hsa05165 )
- Human T-cell leukemia virus 1 infection (hsa05166 )
- Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
- Human immunodeficiency virus 1 infection (hsa05170 )
- Pathways in cancer (hsa05200 )
- Viral carcinogenesis (hsa05203 )
- Proteoglycans in cancer (hsa05205 )
- MicroRNAs in cancer (hsa05206 )
- Colorectal cancer (hsa05210 )
- Renal cell carcinoma (hsa05211 )
- Pancreatic cancer (hsa05212 )
- Endometrial cancer (hsa05213 )
- Glioma (hsa05214 )
- Prostate cancer (hsa05215 )
- Thyroid cancer (hsa05216 )
- Melanoma (hsa05218 )
- Bladder cancer (hsa05219 )
- Chronic myeloid leukemia (hsa05220 )
- Acute myeloid leukemia (hsa05221 )
- Non-small cell lung cancer (hsa05223 )
- Breast cancer (hsa05224 )
- Hepatocellular carcinoma (hsa05225 )
- Gastric cancer (hsa05226 )
- Central carbon metabolism in cancer (hsa05230 )
- Choline metabolism in cancer (hsa05231 )
- PD-L1 expression and PD-1 checkpoint pathway in cancer (hsa05235 )
|
Reactome Pathway |
- Activation of RAS in B cells (R-HSA-1169092 )
- Constitutive Signaling by Ligand-Responsive EGFR Cancer Variants (R-HSA-1236382 )
- SHC1 events in ERBB2 signaling (R-HSA-1250196 )
- SHC1 events in ERBB4 signaling (R-HSA-1250347 )
- Signaling by SCF-KIT (R-HSA-1433557 )
- Signalling to RAS (R-HSA-167044 )
- p38MAPK events (R-HSA-171007 )
- GRB2 events in EGFR signaling (R-HSA-179812 )
- SHC1 events in EGFR signaling (R-HSA-180336 )
- Downstream signal transduction (R-HSA-186763 )
- GRB2 events in ERBB2 signaling (R-HSA-1963640 )
- Tie2 Signaling (R-HSA-210993 )
- EGFR Transactivation by Gastrin (R-HSA-2179392 )
- DAP12 signaling (R-HSA-2424491 )
- SHC-related events triggered by IGF1R (R-HSA-2428933 )
- FCERI mediated MAPK activation (R-HSA-2871796 )
- NCAM signaling for neurite out-growth (R-HSA-375165 )
- Ca2+ pathway (R-HSA-4086398 )
- Ras activation upon Ca2+ influx through NMDA receptor (R-HSA-442982 )
- VEGFR2 mediated cell proliferation (R-HSA-5218921 )
- CD209 (DC-SIGN) signaling (R-HSA-5621575 )
- Constitutive Signaling by EGFRvIII (R-HSA-5637810 )
- SHC-mediated cascade (R-HSA-5654688 )
- FRS-mediated FGFR1 signaling (R-HSA-5654693 )
- SHC-mediated cascade (R-HSA-5654699 )
- FRS-mediated FGFR2 signaling (R-HSA-5654700 )
- SHC-mediated cascade (R-HSA-5654704 )
- FRS-mediated FGFR3 signaling (R-HSA-5654706 )
- FRS-mediated FGFR4 signaling (R-HSA-5654712 )
- SHC-mediated cascade (R-HSA-5654719 )
- Signaling by FGFR2 in disease (R-HSA-5655253 )
- Signaling by FGFR4 in disease (R-HSA-5655291 )
- Signaling by FGFR1 in disease (R-HSA-5655302 )
- Signaling by FGFR3 in disease (R-HSA-5655332 )
- Regulation of RAS by GAPs (R-HSA-5658442 )
- RAF activation (R-HSA-5673000 )
- RAF/MAP kinase cascade (R-HSA-5673001 )
- MAP2K and MAPK activation (R-HSA-5674135 )
- Negative regulation of MAPK pathway (R-HSA-5675221 )
- Signaling by moderate kinase activity BRAF mutants (R-HSA-6802946 )
- Signaling by high-kinase activity BRAF mutants (R-HSA-6802948 )
- Signaling by BRAF and RAF1 fusions (R-HSA-6802952 )
- RAS signaling downstream of NF1 loss-of-function variants (R-HSA-6802953 )
- Paradoxical activation of RAF signaling by kinase inactive BRAF (R-HSA-6802955 )
- Insulin receptor signalling cascade (R-HSA-74751 )
- PTK6 Regulates RHO GTPases, RAS GTPase and MAP kinases (R-HSA-8849471 )
- MET activates RAS signaling (R-HSA-8851805 )
- RUNX3 regulates p14-ARF (R-HSA-8951936 )
- Activated NTRK2 signals through RAS (R-HSA-9026519 )
- Erythropoietin activates RAS (R-HSA-9027284 )
- Activated NTRK2 signals through FRS2 and FRS3 (R-HSA-9028731 )
- Activated NTRK3 signals through RAS (R-HSA-9034864 )
- FLT3 Signaling (R-HSA-9607240 )
- Constitutive Signaling by Overexpressed ERBB2 (R-HSA-9634285 )
- Estrogen-stimulated signaling through PRKCZ (R-HSA-9634635 )
- RAS processing (R-HSA-9648002 )
- Signaling downstream of RAS mutants (R-HSA-9649948 )
- Signaling by RAF1 mutants (R-HSA-9656223 )
- Signaling by ERBB2 KD Mutants (R-HSA-9664565 )
- Signaling by ERBB2 ECD mutants (R-HSA-9665348 )
- Signaling by ERBB2 TMD/JMD mutants (R-HSA-9665686 )
- Signaling by phosphorylated juxtamembrane, extracellular and kinase domain KIT mutants (R-HSA-9670439 )
- Signaling by PDGFRA transmembrane, juxtamembrane and kinase domain mutants (R-HSA-9673767 )
- Signaling by PDGFRA extracellular domain mutants (R-HSA-9673770 )
- Signaling by CSF3 (G-CSF) (R-HSA-9674555 )
- Signaling by FLT3 fusion proteins (R-HSA-9703465 )
- Signaling by FLT3 ITD and TKD mutants (R-HSA-9703648 )
- Signaling by RAS GAP mutants (R-HSA-9753510 )
- Signaling by RAS GTPase mutants (R-HSA-9753512 )
- SOS-mediated signalling (R-HSA-112412 )
|
|
|
|
|
|
|