Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTBA219)

• DTT Name: High mobility group protein HMG-I/Y (HMGA1)
• Synonyms: High mobility group protein R; High mobility group protein HMG-I/HMG-Y; High mobility group protein A1; High mobility group AT-hook protein 1; HMGIY; HMG-I(Y)
• Gene Name: HMGA1
• DTT Type: Literature-reported target; [1]
• UniProt ID: HMGA1_HUMAN
• TTD ID: T68211
• Sequence:
  MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGR
  PKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ
• Function: It is suggested that these proteins could function in nucleosome phasing and in the 3'-end processing of mRNA transcripts. They are also involved in the transcription regulation of genes containing, or in close proximity to A+T-rich regions. HMG-I/Y bind preferentially to the minor groove of A+T rich regions in double-stranded DNA.
• Reactome Pathway:
  2-LTR circle formation (R-HSA-164843)
  Integration of viral DNA into host genomic DNA (R-HSA-175567)
  Autointegration results in viral DNA circles (R-HSA-177539)
  APOBEC3G mediated resistance to HIV-1 infection (R-HSA-180689)
  Vpr-mediated nuclear import of PICs (R-HSA-180910)
  Formation of Senescence-Associated Heterochromatin Foci (SAHF) (R-HSA-2559584)
  Integration of provirus (R-HSA-162592)

References

• [1] HMG-I/Y, a new c-Myc target gene and potential oncogene. Mol Cell Biol. 2000 Aug;20(15):5490-502.