Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTBJEZ5)

DTT Name	Leptin (LEP)
Synonyms	Obesity factor; Obese protein; LEP
Gene Name	LEP
DTT Type	Literature-reported target	[1]
UniProt ID	LEP_HUMAN
TTD ID	T79485
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGL DFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLP WASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Function	May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass.
KEGG Pathway	Cytokine-cytokine receptor interaction (hsa04060 ) Neuroactive ligand-receptor interaction (hsa04080 ) AMPK signaling pathway (hsa04152 ) JAK-STAT signaling pathway (hsa04630 ) Adipocytokine signaling pathway (hsa04920 ) Non-alcoholic fatty liver disease (hsa04932 )
Reactome Pathway	Transcriptional regulation of white adipocyte differentiation (R-HSA-381340 ) Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1) (R-HSA-381771 ) Synthesis, secretion, and deacylation of Ghrelin (R-HSA-422085 ) Signaling by Leptin (R-HSA-2586552 )

References

1	Monitoring calcific aortic valve disease: the role of biomarkers. Curr Med Chem. 2012;19(16):2548-54.