Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTBN5I7)

• DTT Name: B-cell-specific glycoprotein B29 (CD79B)
• Synonyms: Immunoglobulinassociated B29 protein; Immunoglobulin-associated B29 protein; Igbeta; Ig-beta; IGB; CD79b; Bcellspecific glycoprotein B29; Bcell antigen receptor complexassociated protein beta chain; B29; B-cell antigen receptor complex-associated protein beta chain
• Gene Name: CD79B
• DTT Type: Successful target; [1]
• BioChemical Class: Immunoglobulin
• UniProt ID: CD79B_HUMAN
• TTD ID: T08306
• Sequence:
  MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFT
  VKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIY
  FCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLL
  LDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
• Function: Enhances phosphorylation of CD79A, possibly by recruiting kinases which phosphorylate CD79A or by recruiting proteins which bind to CD79A and protect it from dephosphorylation. Required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation.
• KEGG Pathway: B cell receptor signaling pathway (hsa04662)
• Reactome Pathway: Antigen activates B Cell Receptor (BCR) leading to generation of second messengers (R-HSA-983695)

Molecular Interaction Atlas (MIA) of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Polatuzumab vedotin	DMF6Y0L	Diffuse large B-cell lymphoma	2A81	Approved	[2]

4 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
DCDS-4501A	DMQRCX5	Diffuse large B-cell lymphoma	2A81	Phase 2	[3]
Polivy	DMFCIKN	Mantle cell lymphoma	2A85.5	Phase 2	[4]
RG7596	DMVXGU0	Haematological malignancy	2B33.Y	Phase 2	[5]
MGD010	DMA368V	Autoimmune disease	4A40-4A45	Phase 1	[6]

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
CD79-targeted immunotoxins	DMWP63C	Non-hodgkin lymphoma	2B33.5	Investigative	[5]

References

• [1] Safety and activity of the anti-CD79B antibody-drug conjugate polatuzumab vedotin in relapsed or refractory B-cell non-Hodgkin lymphoma and chronic lymphocytic leukaemia: a phase 1 study. Lancet Oncol. 2015 Jun;16(6):704-15.
• [2] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2019
• [3] Marine-Sourced Anti-Cancer and Cancer Pain Control Agents in Clinical and Late Preclinical Development. Mar Drugs. 2014 January; 12(1): 255-278.
• [4] Polatuzumab Vedotin: First Global Approval. Drugs. 2019 Sep;79(13):1467-1475.
• [5] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2852).
• [6] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)