Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTBRUGA)
DTT Name | CDK inhibitor 4C p18-INK4c (CDKN2C) | ||||
---|---|---|---|---|---|
Synonyms | P18-INK6; P18-INK4c; P18(INK4c) protein; P18(INK4c); P18 INK4c protein; Cyclin-dependent kinase 6 inhibitor; Cyclin-dependent kinase 4 inhibitor C | ||||
Gene Name | CDKN2C | ||||
DTT Type |
Literature-reported target
|
[1] | |||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRG
ANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVE FLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ |
||||
Function | Inhibits cell growth and proliferation with a correlated dependence on endogenous retinoblastoma protein RB. Interacts strongly with CDK6, weakly with CDK4. | ||||
KEGG Pathway | |||||
Reactome Pathway | |||||