Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTBXVDE)
| DTT Name | ID1 messenger RNA (ID1 mRNA) | ||||
|---|---|---|---|---|---|
| Synonyms | bHLHb24 (mRNA); Inhibitor of differentiation 1 (mRNA); Inhibitor of DNA binding 1 (mRNA); ID (mRNA); DNA-binding protein inhibitor ID-1 (mRNA); Class B basic helix-loop-helix protein 24 (mRNA) | ||||
| Gene Name | ID1 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
mRNA target
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQ
QVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGG RGLPVRAPLSTLNGEISALTAEAACVPADDRILCR |
||||
| Function |
Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer. Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity.
|
||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||