Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTC4IMS)

• DTT Name: NKG2-A/B-activating NK receptor (NKG2A)
• Synonyms: NKG2A/NKG2B type II integral membrane protein; NKG2A/Bactivating NK receptor; NK cell receptor A; KLRC1; CD159a; CD159 antigenlike family member A
• Gene Name: KLRC1
• DTT Type: Clinical trial target; [1]
• UniProt ID: NKG2A_HUMAN
• TTD ID: T15783
• Sequence:
  MDNQGVIYSDLNLPPNPKRQQRKPKGNKNSILATEQEITYAELNLQKASQDFQGNDKTYH
  CKDLPSAPEKLIVGILGIICLILMASVVTIVVIPSTLIQRHNNSSLNTRTQKARHCGHCP
  EEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRN
  SSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL
• Function: Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.
• KEGG Pathway:
  Antigen processing and presentation (hsa04612)
  Natural killer cell mediated cytotoxicity (hsa04650)
  Graft-versus-host disease (hsa05332)
• Reactome Pathway: Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933)

Molecular Interaction Atlas (MIA) of This DTT

3 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
NN8765	DMCFPBE	Rheumatoid arthritis	FA20	Phase 2	[1]
BMS-986315	DMTEY1L	Solid tumour/cancer	2A00-2F9Z	Phase 1/2	[2]
Monalizumab	DMG7XHE	Chronic lymphocytic leukaemia	2A82.0	Phase 1/2	[3]

1 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
IM1240	DMTV0DK	Aggressive cancer	2A00-2F9Z	Preclinical	[4]

References

• [1] Handbook of Therapeutic Antibodies. 2014. 1. Page(1098).
• [2] ClinicalTrials.gov (NCT04349267) Study of BMS-986315 Alone and in Combination With Nivolumab or Cetuximab in Participants With Advanced Solid Tumors. U.S. National Institutes of Health.
• [3] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [4] Clinical pipeline report, company report or official report of Purple