Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTCDFR1)
| DTT Name | S100 calcium-binding protein A3 (S100A3) | ||||
|---|---|---|---|---|---|
| Synonyms | S100E; Protein S-100E | ||||
| Gene Name | S100A3 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
S100 calcium-binding protein
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMS
VLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ |
||||
| Function | Binds both calcium and zinc. May be involved in calcium-dependent cuticle cell differentiation, hair shaft and hair cuticular barrier formation. | ||||