Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTCE793)

• DTT Name: Cyclic-AMP-dependent transcription factor ATF-3 (ATF3)
• Synonyms: cAMP-dependent transcription factor ATF-3; Cyclic AMP-dependent transcription factor ATF-3; Activating transcription factor 3
• Gene Name: ATF3
• DTT Type: Literature-reported target; [1]
• BioChemical Class: Basic leucine zipper bZIP
• UniProt ID: ATF3_HUMAN
• TTD ID: T11966
• Sequence:
  MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSS
  ALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEK
  LESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQ
  S
• Function: Represses transcription from promoters with ATF sites. It may repress transcription by stabilizing the binding of inhibitory cofactors at the promoter. Isoform 2 activates transcription presumably by sequestering inhibitory cofactors away from the promoters. This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters.
• Reactome Pathway:
  Response of EIF2AK4 (GCN2) to amino acid deficiency (R-HSA-9633012)
  Response of EIF2AK1 (HRI) to heme deficiency (R-HSA-9648895)
  ATF4 activates genes in response to endoplasmic reticulum stress (R-HSA-380994)

References

• [1] Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34.