Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTCGSZ4)

• DTT Name: Pancreatic alpha-amylase (AMY2A)
• Synonyms: PA; 1,4-alpha-D-glucan glucanohydrolase
• Gene Name: AMY2A
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Glycosylase
• UniProt ID: AMYP_HUMAN
• TTD ID: T86918
• EC Number: EC 3.2.1.1
• Sequence:
  MKFFLLLFTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPP
  NENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGN
  AVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGL
  LDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAG
  SKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG
  FVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWP
  RQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQP
  FTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGI
  KIYVSDDGKAHFSISNSAEDPFIAIHAESKL
• Function: Hydrolyses alpha bonds of large, alpha-linked polysaccharides, such as starch and glycogen, yielding glucose and maltose.
• KEGG Pathway:
  Starch and sucrose metabolism (hsa00500)
  Metabolic pathways (hsa01100)
  Salivary secretion (hsa04970)
  Pancreatic secretion (hsa04972)
  Carbohydrate digestion and absorption (hsa04973)
• Reactome Pathway: Digestion of dietary carbohydrate (R-HSA-189085)

Molecular Interaction Atlas (MIA) of This DTT

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Pancrecarb	DMOML9Q	Pancreatic malfunction	DC30-DC3Z	NDA filed	[1]
Liprotamase	DMNF4UH	Cystic fibrosis	CA25	Phase 3	[2]

11 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
4,6-Dideoxy-4-Amino-Alpha-D-Glucose	DMBZIG7	Discovery agent	N.A.	Investigative	[3]
5-Hydroxymethyl-Chonduritol	DMZHVRW	Discovery agent	N.A.	Investigative	[3]
6-Deoxy-Alpha-D-Glucose	DM9HBY5	Discovery agent	N.A.	Investigative	[3]
Acanthus ilicifolius Linn	DMZDFRI	Discovery agent	N.A.	Investigative	[4]
Acarbose Derived Hexasaccharide	DMS9COH	Discovery agent	N.A.	Investigative	[3]
Alpha-acarviosinyl-(1-->7)-3-alpha-D-glucopyranosylpropen	DMHV14R	Discovery agent	N.A.	Investigative	[5]
Alpha-acarviosinyl-(1-->9)-3-alpha-D-glucopyranosylpropen	DM4IXUQ	Discovery agent	N.A.	Investigative	[5]
Beta-D-Glucose	DM5IHYP	Discovery agent	N.A.	Investigative	[3]
Hydroxycitric acid	DMY0A9E	Discovery agent	N.A.	Investigative	[6]
Maltosyl-Alpha (1,4)-D-Gluconhydroximo-1,5-Lactam	DMMY542	Discovery agent	N.A.	Investigative	[7]
Pyroglutamic Acid	DMROZUA	Discovery agent	N.A.	Investigative	[3]

The Drug-Metabolizing Enzyme (DME) Role of This DTT

• DTT DME Name: Pancreatic alpha-amylase (AMY2A) DME Info
• Gene Name: AMY2A

1 Approved Drug(s) Metabolized by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Icodextrin	DM648X9	Kidney disease	GC2Z	Approved	[8]

References

• [1] Clinical pipeline report, company report or official report of Digestive Care.
• [2] Clinical pipeline report, company report or official report of Anthera Pharmaceuticals.
• [3] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
• [4] Four acarviosin-containing oligosaccharides identified from Streptomyces coelicoflavus ZG0656 are potent inhibitors of alpha-amylase. Carbohydr Res. 2008 Apr 7;343(5):882-92.
• [5] Enzymatic synthesis of a selective inhibitor for alpha-glucosidases: alpha-acarviosinyl-(1-->9)-3-alpha-D-glucopyranosylpropen. J Agric Food Chem. 2008 Jul 9;56(13):5324-30.
• [6] Chemistry, physiological properties, and microbial production of hydroxycitric acid. Appl Microbiol Biotechnol. 2007 Jul;75(5):977-82.
• [7] DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-41.
• [8] Analytical interferences in point-of-care testing glucometers by icodextrin and its metabolites: an overview. Perit Dial Int. 2009 Jul-Aug;29(4):377-83.