Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTCH81V)
DTT Name | Bacterial NADH-dependent enoyl-ACP reductase 1 (Bact fabI1) | ||||
---|---|---|---|---|---|
Synonyms | NADH-dependent enoyl-ACP reductase 1; Enoyl-[acyl-carrier-protein] reductase [NADH] 1 | ||||
Gene Name | Bact fabI1 | ||||
DTT Type |
Literature-reported target
|
[1] | |||
BioChemical Class |
CH-CH donor oxidoreductase
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MAQASGLMNGKRGVIMGVANNRSIAWGIAKALAEAGAEIALTWQGDALKKRVEPLAQELG
AFMAGHCDVTDLATIDAVFSALEEKWGKIDFVVHAIAFSDKDELTGRYLDTSRDNFARTM DISVYSFTAVAARADRVMNDGGSILTLTYYGAEKVMPHYNVMGVAKAALEASVRYLAVDL GNRGIRVNAISAGPIKTLAASGIGDFRYILKWNEYNAPLKRTVSIEEVGNSALYLLSDLS SGVTGEVHHVDSGYHTVGMKAVDAPDISVLKD |
||||
Function |
A key enzyme of the type II fatty acid synthesis (FAS) system. Essential for bacterial metabolism and its sequence conservation across many bacterial species but distinctly different from those of mammalian fatty acid biosynthesis enzymes.
|
||||
KEGG Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||