Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTCHGVF)
| DTT Name | HUMAN NADH:ubiquinone oxidoreductase complex assembly factor 2 (NDUFAF2) | ||||
|---|---|---|---|---|---|
| Synonyms | NDUFA12-like protein; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2; Myc-induced mitochondrial protein ; MMTN ; Mimitin ; B17.2-like; B17.2L | ||||
| Gene Name | NDUFAF2 | ||||
| BioChemical Class |
Complex I NDUFA12 subunit family
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MGWSQDLFRALWRSLSREVKEHVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEV
DYEAGDIPTEWEAWIRRTRKTPPTMEEILKNEKHREEIKIKSQDFYEKEKLLSKETSEEL LPPPVQTQIKGHASAPYFGKEEPSVAPSSTGKTFQPGSWMPRDGKSHNQ |
||||
| Function | Human protein NADH:ubiquinone oxidoreductase complex assembly factor 2 interacts with SARS-CoV-2 Nsp7 protein with high significance, which indicates NDUFAF2 as a potential therapeutic target. | ||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||