Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTCJTWF)
DTT Name | Insulin-like growth factor-binding protein 1 (IGFBP1) | ||||
---|---|---|---|---|---|
Synonyms | Placental protein 12; PP12; KITLG; IGFBP-1; IGF-binding protein 1; IBP1; IBP-1 | ||||
Gene Name | IGFBP1 | ||||
DTT Type |
Literature-reported target
|
[1] | |||
BioChemical Class |
Insulin-like growth factor binding
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCC
PMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGS PESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIEL YRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIP GSPEIRGDPNCQIYFNVQN |
||||
Function |
IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration.
|
||||
Reactome Pathway |
|
||||