Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTCL30I)

DTT Name	Vasoactive intestinal polypeptide receptor 1 (VIPR1)
Synonyms	Vasoactive intestinal peptide/pituitary adenylate cyclase activating polypeptide receptor-1; Vasoactive intestinal peptide receptor 1; VPAC1; VPAC-1; VIPR1; VIP-R-1; Pituitary adenylate cyclase activating polypeptide type II receptor; PACAP-R-2; PACAP type II receptor
Gene Name	VIPR1
DTT Type	Clinical trial target	[1]
BioChemical Class	GPCR secretin
UniProt ID	VIPR1_HUMAN
TTD ID	T86364
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MRPPSPLPARWLCVLAGALAWALGPAGGQAARLQEECDYVQMIEVQHKQCLEEAQLENET IGCSKMWDNLTCWPATPRGQVVVLACPLIFKLFSSIQGRNVSRSCTDEGWTHLEPGPYPI ACGLDDKAASLDEQQTMFYGSVKTGYTIGYGLSLATLLVATAILSLFRKLHCTRNYIHMH LFISFILRAAAVFIKDLALFDSGESDQCSEGSVGCKAAMVFFQYCVMANFFWLLVEGLYL YTLLAVSFFSERKYFWGYILIGWGVPSTFTMVWTIARIHFEDYGCWDTINSSLWWIIKGP ILTSILVNFILFICIIRILLQKLRPPDIRKSDSSPYSRLARSTLLLIPLFGVHYIMFAFF PDNFKPEVKMVFELVVGSFQGFVVAILYCFLNGEVQAELRRKWRRWHLQGVLGWNPKYRH PSGGSNGATCSTQVSMLTRVSPGARRSSSFQAEVSLV
Function	This is a receptor for vip. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The affinity is vip = pacap-27 > pacap-38.
KEGG Pathway	Neuroactive ligand-receptor interaction (hsa04080 )
Reactome Pathway	G alpha (s) signalling events (R-HSA-418555 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Vasoactive intestinal peptide	DMRJ5LP	Chronic obstructive pulmonary disease	CA22	Phase 2	[1]
------------------------------------------------------------------------------------

2 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
helodermin	DMIUABO	Discovery agent	N.A.	Investigative	[2]
PACAP-27	DMB26IK	Discovery agent	N.A.	Investigative	[3]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA)

Jump to Detail Molecular Expression Atlas of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Chronic obstructive pulmonary disease	CA23	Lung tissue	6.47E-01	-0.16	-0.14
Chronic obstructive pulmonary disease	CA23	Small airway epithelium	4.24E-01	-0.12	-0.26
------------------------------------------------------------------------------------

References

1	Emerging treatments for pulmonary arterial hypertension. Expert Opin Emerg Drugs. 2006 Nov;11(4):609-19.
2	Stable expression of the recombinant human VIP1 receptor in clonal Chinese hamster ovary cells: pharmacological, functional and molecular properties. Eur J Pharmacol. 1996 Apr 29;302(1-3):207-14.
3	A systematic comparison of intracellular cyclic AMP and calcium signalling highlights complexities in human VPAC/PAC receptor pharmacology. Neuropharmacology. 2006 Nov;51(6):1086-98.