| DTT Name |
HUAMN monocyte differentiation antigen CD14 (CD14)
|
| Synonyms |
Myeloid cell-specific leucine-rich glycoprotein |
| Gene Name |
CD14
|
| UniProt ID |
|
| TTD ID |
|
| 3D Structure |
|
| Sequence |
MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIH
AGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKE
LTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQA
HSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGV
CAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLR
VLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVG
VSGTLVLLQGARGFA
|
| Function |
In concert with LBP, binds to monomeric lipopolysaccharide and delivers it to the LY96/TLR4 complex, thereby mediating the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Acts as a coreceptor for TLR2:TLR6 heterodimer in response to diacylated lipopeptides and for TLR2:TLR1 heterodimer in response to triacylated lipopeptides, these clusters trigger signaling from the cell surface and subsequently are targeted to the Golgi in a lipid-raft dependent pathway. Binds electronegative LDL (LDL(-)) and mediates the cytokine release induced by LDL(-). Coreceptor for bacterial lipopolysaccharide.
|
| KEGG Pathway |
- MAPK signaling pathway (hsa04010 )
- NF-kappa B signaling pathway (hsa04064 )
- Phagosome (hsa04145 )
- Toll-like receptor signaling pathway (hsa04620 )
- Hematopoietic cell lineage (hsa04640 )
- Alcoholic liver disease (hsa04936 )
- Shigellosis (hsa05131 )
- Salmonella infection (hsa05132 )
- Pertussis (hsa05133 )
- Legionellosis (hsa05134 )
- Amoebiasis (hsa05146 )
- Tuberculosis (hsa05152 )
- Transcriptional misregulation in cancer (hsa05202 )
- Acute myeloid leukemia (hsa05221 )
- Lipid and atherosclerosis (hsa05417 )
|
| Reactome Pathway |
- Caspase activation via Death Receptors in the presence of ligand (R-HSA-140534 )
- Toll Like Receptor 4 (TLR4) Cascade (R-HSA-166016 )
- Transfer of LPS from LBP carrier to CD14 (R-HSA-166020 )
- MyD88 (R-HSA-166058 )
- MyD88-independent TLR4 cascade (R-HSA-166166 )
- Toll Like Receptor TLR1 (R-HSA-168179 )
- Toll Like Receptor TLR6 (R-HSA-168188 )
- TRIF-mediated programmed cell death (R-HSA-2562578 )
- MyD88 deficiency (TLR2/4) (R-HSA-5602498 )
- IRAK4 deficiency (TLR2/4) (R-HSA-5603041 )
- Regulation of TLR by endogenous ligand (R-HSA-5686938 )
- Neutrophil degranulation (R-HSA-6798695 )
- Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon (R-HSA-936964 )
- IKK complex recruitment mediated by RIP1 (R-HSA-937041 )
- TRAF6-mediated induction of TAK1 complex within TLR4 complex (R-HSA-937072 )
- IRAK2 mediated activation of TAK1 complex upon TLR7/8 or 9 stimulation (R-HSA-975163 )
- ER-Phagosome pathway (R-HSA-1236974 )
|
|
|
|
|
|
|
