| DTT Name |
GN-binding protein G(I)/G(S)/G(O) gamma-7 (GNG7)
|
| Synonyms |
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7; GNGT7; G protein gamma 7 |
| Gene Name |
GNG7
|
| DTT Type |
Literature-reported target
|
[1] |
| UniProt ID |
|
| TTD ID |
|
| 3D Structure |
|
| Sequence |
MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFK
DKKPCIIL
|
| Function |
The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Plays a role in the regulation of adenylyl cyclase signaling in certain regions of the brain. Plays a role in the formation or stabilzation of a G protein heterotrimer (G(olf) subunit alpha-beta-gamma-7) that is required for adenylyl cyclase activity in the striatum. Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems.
|
| KEGG Pathway |
- Ras signaling pathway (hsa04014 )
- Chemokine signaling pathway (hsa04062 )
- PI3K-Akt signaling pathway (hsa04151 )
- Apelin signaling pathway (hsa04371 )
- Circadian entrainment (hsa04713 )
- Retrograde endocannabinoid signaling (hsa04723 )
- Glutamatergic synapse (hsa04724 )
- Cholinergic synapse (hsa04725 )
- Serotonergic synapse (hsa04726 )
- GABAergic synapse (hsa04727 )
- Dopaminergic synapse (hsa04728 )
- Olfactory transduction (hsa04740 )
- Relaxin signaling pathway (hsa04926 )
- Morphine addiction (hsa05032 )
- Alcoholism (hsa05034 )
- Human cytomegalovirus infection (hsa05163 )
- Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
- Human immunodeficiency virus 1 infection (hsa05170 )
- Pathways in cancer (hsa05200 )
|
| Reactome Pathway |
- Glucagon signaling in metabolic regulation (R-HSA-163359 )
- G-protein activation (R-HSA-202040 )
- Glucagon-like Peptide-1 (GLP1) regulates insulin secretion (R-HSA-381676 )
- ADP signalling through P2Y purinoceptor 12 (R-HSA-392170 )
- G beta (R-HSA-392451 )
- Prostacyclin signalling through prostacyclin receptor (R-HSA-392851 )
- Adrenaline,noradrenaline inhibits insulin secretion (R-HSA-400042 )
- Ca2+ pathway (R-HSA-4086398 )
- G alpha (q) signalling events (R-HSA-416476 )
- G alpha (12/13) signalling events (R-HSA-416482 )
- G beta (R-HSA-418217 )
- G alpha (s) signalling events (R-HSA-418555 )
- ADP signalling through P2Y purinoceptor 1 (R-HSA-418592 )
- G alpha (i) signalling events (R-HSA-418594 )
- G alpha (z) signalling events (R-HSA-418597 )
- Glucagon-type ligand receptors (R-HSA-420092 )
- Thromboxane signalling through TP receptor (R-HSA-428930 )
- Vasopressin regulates renal water homeostasis via Aquaporins (R-HSA-432040 )
- Thrombin signalling through proteinase activated receptors (PARs) (R-HSA-456926 )
- Presynaptic function of Kainate receptors (R-HSA-500657 )
- Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding (R-HSA-6814122 )
- G beta (R-HSA-8964315 )
- G beta (R-HSA-8964616 )
- Extra-nuclear estrogen signaling (R-HSA-9009391 )
- GPER1 signaling (R-HSA-9634597 )
- ADORA2B mediated anti-inflammatory cytokines production (R-HSA-9660821 )
- Inhibition of voltage gated Ca2+ channels via Gbeta/gamma subunits (R-HSA-997272 )
- Activation of G protein gated Potassium channels (R-HSA-1296041 )
|
|
|
|
|
|
|
