Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTCTYNP)

• DTT Name: Small cell lung carcinoma cluster 4 antigen (CD24)
• Synonyms: Signal transducer CD24; CD24A
• Gene Name: CD24
• DTT Type: Literature-reported target; [1]
• UniProt ID: CD24_HUMAN
• TTD ID: T65906
• Sequence:
  MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGG
  ALQSTASLFVVSLSLLHLYS
• Function: Signaling could be triggered by the binding of a lectin-like ligand to the CD24 carbohydrates, and transduced by the release of second messengers derived from the GPI-anchor. Modulates B-cell activation responses. Promotes AG-dependent proliferation of B-cells, and prevents their terminal differentiation into antibody-forming cells. In association with SIGLEC10 may be involved in the selective suppression of the immune response to danger-associated molecular patterns (DAMPs) such as HMGB1, HSP70 and HSP90. Plays a role in the control of autoimmunity. May have a pivotal role in cell differentiation of different cell types.
• KEGG Pathway: Hematopoietic cell lineage (hsa04640)
• Reactome Pathway: L1CAM interactions (R-HSA-373760)

Molecular Interaction Atlas (MIA) of This DTT

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
BsAb cG7-MICA	DMJIKHQ	N. A.	N. A.	Investigative	[1]

References

• [1] Targeting CD24 for treatment of colorectal and pancreatic cancer by monoclonal antibodies or small interfering RNA. Cancer Res. 2008 Apr 15;68(8):2803-12.