Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTD3BSX)

• DTT Name: Bone morphogenetic protein 4 (BMP4)
• Synonyms: DVR4; Bone morphogenetic protein 2B; BMP2B; BMP-4; BMP-2B
• Gene Name: BMP4
• DTT Type: Literature-reported target; [1]
• BioChemical Class: Growth factor
• UniProt ID: BMP4_HUMAN
• TTD ID: T77410
• Sequence:
  MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEAT
  LLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIHSTGLEYPERPASRANTVRSF
  HHEEHLENIPGTSENSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWERGFHRINI
  YEVMKPPAEVVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTH
  LHQTRTHQGQHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQR
  ARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTL
  VNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
• Function: Acts in mesoderm induction, tooth development, limb formation and fracture repair. Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during embryonic mammary development and to inhibit hair follicle induction. Induces cartilage and bone formation.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  TGF-beta signaling pathway (hsa04350)
  Hippo signaling pathway (hsa04390)
  Signaling pathways regulating pluripotency of stem cells (hsa04550)
  Thyroid hormone signaling pathway (hsa04919)
  Pathways in cancer (hsa05200)
  Basal cell carcinoma (hsa05217)
  Fluid shear stress and atherosclerosis (hsa05418)
• Reactome Pathway:
  Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426)
  Post-translational protein phosphorylation (R-HSA-8957275)
  Molecules associated with elastic fibres (R-HSA-2129379)

References

• [1] Bone morphogenetic protein-4: a novel therapeutic target for pathological cardiac hypertrophy/heart failure. Heart Fail Rev. 2014 Nov;19(6):781-8.