| DTT Name |
DNA-directed RNA polymerase II RPB7 (hsRPB7)
|
| Synonyms |
RPB7; Human RNA polymerase II seventh subunit; HsRPB7 |
| Gene Name |
POLR2G
|
| DTT Type |
Literature-reported target
|
[1] |
| BioChemical Class |
Kinase
|
| UniProt ID |
|
| TTD ID |
|
| 3D Structure |
|
| Sequence |
MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQ
PGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFD
PNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS
|
| Function |
Dna-dependent rna polymerase catalyzes the transcription of dna into rna using the four ribonucleoside triphosphates as substrates. It is suggested that rpb7 contributes to the function of rna polymerase ii in the absence of rpb4.
|
| KEGG Pathway |
- RNA polymerase (hsa03020 )
- Huntington disease (hsa05016 )
|
| Reactome Pathway |
- Formation of the Early Elongation Complex (R-HSA-113418 )
- Formation of HIV elongation complex in the absence of HIV Tat (R-HSA-167152 )
- Formation of the HIV-1 Early Elongation Complex (R-HSA-167158 )
- RNA Pol II CTD phosphorylation and interaction with CE during HIV infection (R-HSA-167160 )
- HIV Transcription Initiation (R-HSA-167161 )
- RNA Polymerase II HIV Promoter Escape (R-HSA-167162 )
- Transcription of the HIV genome (R-HSA-167172 )
- Formation of HIV-1 elongation complex containing HIV-1 Tat (R-HSA-167200 )
- Pausing and recovery of Tat-mediated HIV elongation (R-HSA-167238 )
- Abortive elongation of HIV-1 transcript in the absence of Tat (R-HSA-167242 )
- Tat-mediated HIV elongation arrest and recovery (R-HSA-167243 )
- Tat-mediated elongation of the HIV-1 transcript (R-HSA-167246 )
- HIV elongation arrest and recovery (R-HSA-167287 )
- Pausing and recovery of HIV elongation (R-HSA-167290 )
- Viral Messenger RNA Synthesis (R-HSA-168325 )
- MicroRNA (miRNA) biogenesis (R-HSA-203927 )
- Transcriptional regulation by small RNAs (R-HSA-5578749 )
- PIWI-interacting RNA (piRNA) biogenesis (R-HSA-5601884 )
- Activation of anterior HOX genes in hindbrain development during early embryogenesis (R-HSA-5617472 )
- RNA Polymerase II Pre-transcription Events (R-HSA-674695 )
- Formation of TC-NER Pre-Incision Complex (R-HSA-6781823 )
- Transcription-Coupled Nucleotide Excision Repair (TC-NER) (R-HSA-6781827 )
- Dual incision in TC-NER (R-HSA-6782135 )
- Gap-filling DNA repair synthesis and ligation in TC-NER (R-HSA-6782210 )
- TP53 Regulates Transcription of DNA Repair Genes (R-HSA-6796648 )
- FGFR2 alternative splicing (R-HSA-6803529 )
- RNA polymerase II transcribes snRNA genes (R-HSA-6807505 )
- mRNA Capping (R-HSA-72086 )
- mRNA Splicing - Major Pathway (R-HSA-72163 )
- mRNA Splicing - Minor Pathway (R-HSA-72165 )
- Processing of Capped Intron-Containing Pre-mRNA (R-HSA-72203 )
- RNA Polymerase II Promoter Escape (R-HSA-73776 )
- RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (R-HSA-73779 )
- RNA Polymerase II Transcription Initiation (R-HSA-75953 )
- RNA Polymerase II Transcription Elongation (R-HSA-75955 )
- RNA Polymerase II Transcription Initiation And Promoter Clearance (R-HSA-76042 )
- RNA Pol II CTD phosphorylation and interaction with CE (R-HSA-77075 )
- Signaling by FGFR2 IIIa TM (R-HSA-8851708 )
- Estrogen-dependent gene expression (R-HSA-9018519 )
- Inhibition of DNA recombination at telomere (R-HSA-9670095 )
- Formation of RNA Pol II elongation complex (R-HSA-112382 )
|
|
|
|
|
|
|
