Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTDA81R)

• DTT Name: Kallikrein-14 (KLK14)
• Synonyms: hK14; Kallikrein-like protein 6; KLKL6; KLK-L6
• Gene Name: KLK14
• DTT Type: Patented-recorded target; [1]
• BioChemical Class: Peptidase
• UniProt ID: KLK14_HUMAN
• TTD ID: T39195
• EC Number: EC 3.4.21.-
• Sequence:
  MSLRVLGSGTWPSAPKMFLLLTALQVLAIAMTQSQEDENKIIGGHTCTRSSQPWQAALLA
  GPRRRFLCGGALLSGQWVITAAHCGRPILQVALGKHNLRRWEATQQVLRVVRQVTHPNYN
  SRTHDNDLMLLQLQQPARIGRAVRPIEVTQACASPGTSCRVSGWGTISSPIARYPASLQC
  VNINISPDEVCQKAYPRTITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMER
  CALPGYPGVYTNLCKYRSWIEETMRDK
• Function: May activate/inactivate the proteinase-activated receptors F2R, F2RL1 and F2RL3 and other kallikreins including KLK1, KLK3, KLK5 and KLK11. May function in seminal clot liquefaction through direct cleavage of the semenogelin SEMG1 and SEMG2 and activation of KLK3. May function through desmoglein DSG1 cleavage in epidermal desquamation a process by which the most superficial corneocytes are shed from the skin surface. May be involved in several aspects of tumor progression including growth, invasion and angiogenesis. Serine-type endopeptidase with a dual trypsin-like and chymotrypsin-like substrate specificity.
• Reactome Pathway: Formation of the cornified envelope (R-HSA-6809371)

Molecular Interaction Atlas (MIA) of This DTT

2 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
PMID23849879C3	DMUW3MT	Discovery agent	N.A.	Investigative	[1]
PMID25489658C4d	DMWZJT0	Discovery agent	N.A.	Investigative	[2]

References

• [1] 1,2,4-Triazole derivatives as transient inactivators of kallikreins involved in skin diseases. Bioorg Med Chem Lett. 2013 Aug 15;23(16):4547-51.
• [2] Toward the first class of suicide inhibitors of kallikreins involved in skin diseases. J Med Chem. 2015 Jan 22;58(2):598-612.