General Information of Drug Therapeutic Target (DTT) (ID: TTDT8RP)

DTT Name HUMAN casein kinase II (CSK2)
Synonyms Protein kinase CK2; Casein kinase II; CK2; CK II
Gene Name CSK2
BioChemical Class
Kinase
UniProt ID
CSK21_HUMAN ; CSK22_HUMAN ; CSK23_HUMAN ; CSK2B_HUMAN
TTD ID
T86928
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
EC 2.7.11.1
Sequence
MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINIT
NNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTD
FKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAE
FYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYD
QLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDF
LDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANMMSGISSVPT
PSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ
Function
Regulates numerous cellular processes, such as cell cycle progression, apoptosis and transcription, as well as viral infection. May act as a regulatory node which integrates and coordinates numerous signals leading to an appropriate cellular response. During mitosis, functions as a component of the p53/TP53-dependent spindle assembly checkpoint (SAC) that maintains cyclin-B-CDK1 activity and G2 arrest in response to spindle damage. Also required for p53/TP53-mediated apoptosis, phosphorylating 'Ser-392' of p53/TP53 following UV irradiation. Can also negatively regulate apoptosis. Phosphorylates the caspases CASP9 and CASP2 and the apoptotic regulator NOL3. Phosphorylation protects CASP9 from cleavage and activation by CASP8, and inhibits the dimerization of CASP2 and activation of CASP8. Regulates transcription by direct phosphorylation of RNA polymerases I, II, III and IV. Also phosphorylates and regulates numerous transcription factors including NF-kappa-B, STAT1, CREB1, IRF1, IRF2, ATF1, SRF, MAX, JUN, FOS, MYC and MYB. Phosphorylates Hsp90 and its co-chaperones FKBP4 and CDC37, which is essential for chaperone function. Regulates Wnt signaling by phosphorylating CTNNB1 and the transcription factor LEF1. Acts as an ectokinase that phosphorylates several extracellular proteins. During viral infection, phosphorylates various proteins involved in the viral life cycles of EBV, HSV, HBV, HCV, HIV, CMV and HPV. Phosphorylates PML at 'Ser-565' and primes it for ubiquitin-mediated degradation. Plays an important role in the circadian clock function by phosphorylating ARNTL/BMAL1 at 'Ser-90' which is pivotal for its interaction with CLOCK and which controls CLOCK nuclear entry. Phosphorylates CCAR2 at 'Thr-454' in gastric carcinoma tissue. Catalytic subunit of a constitutively active serine/threonine-protein kinase complex that phosphorylates a large number of substrates containing acidic residues C-terminal to the phosphorylated serine or threonine.
KEGG Pathway
Ribosome biogenesis in eukaryotes (hsa03008 )
NF-kappa B signaling pathway (hsa04064 )
Mitophagy - animal (hsa04137 )
Wnt signaling pathway (hsa04310 )
Adherens junction (hsa04520 )
Alzheimer disease (hsa05010 )
Prion disease (hsa05020 )
Pathways of neurodegeneration - multiple diseases (hsa05022 )
Measles (hsa05162 )
PD-L1 expression and PD-1 checkpoint pathway in cancer (hsa05235 )
Reactome Pathway
WNT mediated activation of DVL (R-HSA-201688 )
Condensation of Prometaphase Chromosomes (R-HSA-2514853 )
Signal transduction by L1 (R-HSA-445144 )
Regulation of TP53 Activity through Phosphorylation (R-HSA-6804756 )
Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding (R-HSA-6814122 )
Receptor Mediated Mitophagy (R-HSA-8934903 )
RUNX1 interacts with co-factors whose precise effect on RUNX1 targets is not known (R-HSA-8939243 )
Regulation of PTEN stability and activity (R-HSA-8948751 )
KEAP1-NFE2L2 pathway (R-HSA-9755511 )
Synthesis of PC (R-HSA-1483191 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
1 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Silmitasertib DMQIBZD Cholangiocarcinoma 2C12.10 Investigative [1]
------------------------------------------------------------------------------------

References

1 News report, company report or official report of Senhwa Biosciences, Inc. Senhwa Biosciences Silmitasertib Named as Potential COVID-19 Therapy. 2020 March 31.