Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTDWEA8)

• DTT Name: IGFBP5 messenger RNA (IGFBP5 mRNA)
• Synonyms: Insulin-like growth factor-binding protein 5 (mRNA); IGFBP-5 (mRNA); IGF-binding protein 5 (mRNA); IBP5 (mRNA); IBP-5 (mRNA)
• Gene Name: IGFBP5
• DTT Type: Literature-reported target; [1]
• BioChemical Class: mRNA target
• UniProt ID: IBP5_HUMAN
• TTD ID: T17008
• Sequence:
  MVLLTAVLLLLAAYAGPAQSLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCA
  LAEGQSCGVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHE
  EPTTSEMAEETYSPKIFRPKHTRISELKAEAVKKDRRKKLTQSKFVGGAENTAHPRIISA
  PEMRQESEQGPCRRHMEASLQELKASPRMVPRAVYLPNCDRKGFYKRKQCKPSRGRKRGI
  CWCVDKYGMKLPGMEYVDGDFQCHTFDSSNVE
• Function: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.
• Reactome Pathway:
  Post-translational protein phosphorylation (R-HSA-8957275)
  Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426)
• BioCyc Pathway: MetaCyc:ENSG00000115461-MON

References

• [1] Correlation between the DNA methylation and gene expression of IGFBP5 in breast cancer. Breast Dis. 2016;36(4):123-131.