Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTDY4BS)

• DTT Name: AP-2 transcription factor (TFAP2A)
• Synonyms: Transcription factor AP-2-alpha; TFAP2; Activator protein 2; Activating enhancer-binding protein 2-alpha; AP2TF; AP2-alpha; AP-2
• Gene Name: TFAP2A
• DTT Type: Literature-reported target; [1]
• UniProt ID: AP2A_HUMAN
• TTD ID: T71317
• Sequence:
  MLWKLTDNIKYEDCEDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPP
  PYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSG
  LDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPV
  SLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSP
  PECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHL
  ARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLG
  NSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNS
  HTDNNAKSSDKEEKHRK
• Function: AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. AP-2-alpha is the only AP-2 protein required for early morphogenesis of the lens vesicle. Together with the CITED2 coactivator, stimulates the PITX2 P1 promoter transcription activation. Associates with chromatin to the PITX2 P1 promoter region. Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes.
• Reactome Pathway:
  Transcriptional regulation by the AP-2 (TFAP2) family of transcription factors (R-HSA-8864260)
  Negative regulation of activity of TFAP2 (AP-2) family transcription factors (R-HSA-8866904)
  TFAP2 (AP-2) family regulates transcription of other transcription factors (R-HSA-8866906)
  Activation of the TFAP2 (AP-2) family of transcription factors (R-HSA-8866907)
  TFAP2 (AP-2) family regulates transcription of growth factors and their receptors (R-HSA-8866910)
  TFAP2 (AP-2) family regulates transcription of cell cycle factors (R-HSA-8866911)
  TFAP2A acts as a transcriptional repressor during retinoic acid induced cell differentiation (R-HSA-8869496)
  SUMOylation of transcription factors (R-HSA-3232118)

References

• [1] Tfap2a and Foxd3 regulate early steps in the development of the neural crest progenitor population. Dev Biol. 2011 Dec 1;360(1):173-85.