Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTE5ITK)

• DTT Name: Cancer/testis antigen 1 (NY-ESO-1)
• Synonyms: LAGE2B; LAGE2A; LAGE2; LAGE-2; L antigen family member 2; ESO1; Cancer/testis antigen 6.1; CTAG1B; CTAG1; CTAG; CT6.1; Autoimmunogenic cancer/testis antigen NYESO1; Autoimmunogenic cancer/testis antigen NY-ESO-1
• Gene Name: CTAG1A
• DTT Type: Clinical trial target; [1]
• UniProt ID: CTG1B_HUMAN
• TTD ID: T82277
• Sequence:
  MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGA
  PRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPG
  VLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
• Function: Immunogenic protein. Its aberrant re-expression is induced by molecular mechanisms including: DNA demethylation, histone post-translational modification, and microRNA-mediated regulation. The effect of DNA demethylation is evident by the capability of demethylating agents, like 5-aza-2-deoxycytidine, to induce the re-expression of NY-ESO-1 in tumour cells but not in normal epithelial cells.

Molecular Interaction Atlas (MIA) of This DTT

7 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
CDX-1401	DMCGNJ6	Ovarian cancer	2C73	Phase 2	[1]
Anti-NY-ESO-1 CAR-T cells	DM26VCZ	Esophageal cancer	2B70	Phase 1/2	[2]
CV-9201	DMCPZYT	Non-small-cell lung cancer	2C25.Y	Phase 1/2	[3]
GSK-2241658A	DM5VS7B	Melanoma	2C30	Phase 1	[4]
GSK3845097	DM1UQ4Y	Solid tumour/cancer	2A00-2F9Z	Phase 1	[5]
GSK3901961	DMN4I7P	Solid tumour/cancer	2A00-2F9Z	Phase 1	[5]
NY-ESO-1 vaccine	DM0EKUQ	Solid tumour/cancer	2A00-2F9Z	Phase 1	[6]

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Melanoma vaccine (ALVAC)	DM3HIQY	Melanoma	2C30	Discontinued in Phase 2	[7]

References

• [1] National Cancer Institute Drug Dictionary (drug id 651880).
• [2] ClinicalTrials.gov (NCT03638206) Autologous CAR-T/TCR-T Cell Immunotherapy for Malignancies
• [3] National Cancer Institute Drug Dictionary (drug id 648549).
• [4] ClinicalTrials.gov (NCT01213472) Evaluation of a New Anti-cancer Immunotherapy in Patients With Non-operable and Progressing Metastatic Cutaneous Melanoma. U.S. National Institutes of Health.
• [5] Clinical pipeline report, company report or official report of GlaxoSmithKline.
• [6] Multiepitope CD8+ T cell response to a NY-ESO-1 peptide vaccine results in imprecise tumor targeting. J Clin Invest. 2002 December 15; 110(12): 1813-1822.
• [7] Preclinical qualification of a new multi-antigen candidate vaccine for metastatic melanoma. J Immunother. 2010 Oct;33(8):743-58.