Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTE8WGO)

DTT Name	Insulin-like growth factor-II (IGF2)
Synonyms	T3M-11-derived growth factor; Somatomedin-A; Somatomedin A; PP1446; Insulin-like growth factor II; Insulin-like growth factor 2; IGF-II
Gene Name	IGF2
DTT Type	Clinical trial target	[1]
UniProt ID	IGF2_HUMAN
TTD ID	T90572
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MGIPMGKSMLVLLTFLAFASCCIAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVS RRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWK QSTQRLRRGLPALLRARRGHVLAKELEAFREAKRHRPLIALPTQDPAHGGAPPEMASNRK
Function	Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development. IGF-II is influenced by placental lactogen. Also involved in tissue differentiation. Positively regulates myogenic transcription factor MYOD1 function by facilitating the recruitment of transcriptional coactivators, thereby controlling muscle terminal differentiation. In adults, involved in glucose metabolism in adipose tissue, skeletal muscle and liver. Acts as a ligand for integrin which is required for IGF2 signaling. The insulin-like growth factors possess growth-promoting activity.
KEGG Pathway	MAPK signaling pathway (hsa04010 ) Ras signaling pathway (hsa04014 ) PI3K-Akt signaling pathway (hsa04151 ) Pathways in cancer (hsa05200 ) Proteoglycans in cancer (hsa05205 ) Hepatocellular carcinoma (hsa05225 )
Reactome Pathway	Signaling by Type 1 Insulin-like Growth Factor 1 Receptor (IGF1R) (R-HSA-2404192 ) IRS-related events triggered by IGF1R (R-HSA-2428928 ) SHC-related events triggered by IGF1R (R-HSA-2428933 ) Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426 ) Platelet degranulation (R-HSA-114608 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DTT

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Dusigitumab	DM1ZJYS	Breast cancer	2C60-2C65	Phase 2	[1]
Xentuzumab	DM4ZIDH	Breast cancer	2C60-2C65	Phase 2	[1]
------------------------------------------------------------------------------------

References

1	Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)