Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTEMWSD)

• DTT Name: von Hippel-Lindau disease tumor suppressor (VHL)
• Synonyms: pVHL; Protein G7
• Gene Name: VHL
• DTT Type: Patented-recorded target; [1]
• UniProt ID: VHL_HUMAN
• TTD ID: T80423
• Sequence:
  MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPR
  PVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFR
  DAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDI
  VRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
• Function: Seems to act as a target recruitment subunit in the E3 ubiquitin ligase complex and recruits hydroxylated hypoxia-inducible factor (HIF) under normoxic conditions. Involved in transcriptional repression through interaction with HIF1A, HIF1AN and histone deacetylases. Ubiquitinates, in an oxygen-responsive manner, ADRB2. Involved in the ubiquitination and subsequent proteasomal degradation via the von Hippel-Lindau ubiquitination complex.
• KEGG Pathway:
  HIF-1 signaling pathway (hsa04066)
  Ubiquitin mediated proteolysis (hsa04120)
  Pathways in cancer (hsa05200)
  Renal cell carcinoma (hsa05211)
• Reactome Pathway:
  SUMOylation of ubiquitinylation proteins (R-HSA-3232142)
  Neddylation (R-HSA-8951664)
  Replication of the SARS-CoV-1 genome (R-HSA-9682706)
  Replication of the SARS-CoV-2 genome (R-HSA-9694686)
  RHOBTB3 ATPase cycle (R-HSA-9706019)
  Antigen processing (R-HSA-983168)
  Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha (R-HSA-1234176)

Molecular Interaction Atlas (MIA) of This DTT

1 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Pyrrolidine carboxamide derivative 1	DMJK98Z	N. A.	N. A.	Patented	[1]

References

• [1] Hypoxia-inducible factor (HIF) inhibitors: a patent survey (2011-2015).Expert Opin Ther Pat. 2016;26(3):309-22.