Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTER58P)

• DTT Name: B- and T-lymphocyte attenuator (BTLA)
• Synonyms: CD272; B- and T-lymphocyte-associated protein
• Gene Name: BTLA
• DTT Type: Clinical trial target; [1]
• UniProt ID: BTLA_HUMAN
• TTD ID: T68001
• Sequence:
  MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPV
  KYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQ
  SNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRLLPLGGLPLLITTCFCLFCCLRR
  HQGKQNELSDTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGS
  EVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS
• Function: May interact in cis (on the same cell) or in trans (on other cells) with TNFRSF14. In cis interactions, appears to play an immune regulatory role inhibiting in trans interactions in naive T cells to maintain a resting state. In trans interactions, can predominate during adaptive immune response to provide survival signals to effector T cells. Inhibitory receptor on lymphocytes that negatively regulates antigen receptor signaling via PTPN6/SHP-1 and PTPN11/SHP-2.
• Reactome Pathway: Costimulation by the CD28 family (R-HSA-388841)

Molecular Interaction Atlas (MIA) of This DTT

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
LY3361237	DMHXMYU	Sjogren syndrome	4A43.20	Phase 2	[2]
JS004	DMFMWLQ	Solid tumour/cancer	2A00-2F9Z	Phase 1	[3]

References

• [1] Decreased B and T lymphocyte attenuator in Behcet's disease may trigger abnormal Th17 and Th1 immune responses. Sci Rep. 2016 Feb 4;6:20401.
• [2] ClinicalTrials.gov (NCT05781451) A Phase 2, Open Label Study of Anti-BTLA Agonist Therapy in Subjects With Primary Sjogren's Syndrome. U.S.National Institutes of Health.
• [3] Clinical pipeline report, company report or official report of Junshi Biosciences.