Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTEST6I)

• DTT Name: Vascular endothelial cell growth inhibitor (TNFSF15)
• Synonyms: Tumor necrosis factor ligand superfamily member 15, secreted form; Tumor necrosis factor ligand superfamily member 15; TNFSF15; TNF ligand-related molecule 1
• Gene Name: TNFSF15
• DTT Type: Literature-reported target; [1]
• BioChemical Class: Cytokine: tumor necrosis factor
• UniProt ID: TNF15_HUMAN
• TTD ID: T35212
• Sequence:
  MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLR
  AQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWE
  HELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVV
  ITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTK
  EDKTFFGAFLL
• Function: Receptor for TNFRSF25 and TNFRSF6B. Mediates activation of NF-kappa-B. Inhibits vascular endothelial growth and angiogenesis (in vitro). Promotes activation of caspases and apoptosis.
• KEGG Pathway: Cytokine-cytokine receptor interaction (hsa04060)
• Reactome Pathway: TNFs bind their physiological receptors (R-HSA-5669034)

Molecular Interaction Atlas (MIA) of This DTT

3 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
PRA023	DMUY4VV	Crohn disease	DD70	Phase 2	[2]
TEV-48574	DMHWN63	Crohn disease	DD70	Phase 2	[3]
PF-07261271	DM0K4WQ	Inflammatory bowel disease	DD72	Phase 1	[4]

References

• [1] Early Actions of Anti-Vascular Endothelial Growth Factor/Vascular Endothelial Growth Factor Receptor Drugs on Angiogenic Blood Vessels. Am J Pathol. 2017 Oct;187(10):2337-2347.
• [2] Clinical pipeline report, company report or official report of Prometheus Biosciences
• [3] Clinical pipeline report, company report or official report of Teva Pharmaceutical
• [4] Clinical pipeline report, company report or official report of Pfizer