Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTF89GD)

• DTT Name: Interleukin-2 (IL2)
• Synonyms: TCGF; T-cell growth factor; IL-2; Aldesleukin
• Gene Name: IL2
• DTT Type: Successful target; [1]
• BioChemical Class: Cytokine: interleukin
• UniProt ID: IL2_HUMAN
• TTD ID: T61698
• Sequence:
  MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
  TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE
  TTFMCEYADETATIVEFLNRWITFCQSIISTLT
• Function: Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  PI3K-Akt signaling pathway (hsa04151)
  Jak-STAT signaling pathway (hsa04630)
  T cell receptor signaling pathway (hsa04660)
  Intestinal immune network for IgA production (hsa04672)
  Type I diabetes mellitus (hsa04940)
  Chagas disease (American trypanosomiasis) (hsa05142)
  Measles (hsa05162)
  HTLV-I infection (hsa05166)
  Autoimmune thyroid disease (hsa05320)
  Inflammatory bowel disease (IBD) (hsa05321)
  Allograft rejection (hsa05330)
  Graft-versus-host disease (hsa05332)
• Reactome Pathway:
  G beta (R-HSA-392451)
  Interleukin-2 signaling (R-HSA-451927)
  RAF/MAP kinase cascade (R-HSA-5673001)
  Interleukin receptor SHC signaling (R-HSA-912526)
  GPVI-mediated activation cascade (R-HSA-114604)

Molecular Interaction Atlas (MIA) of This DTT

2 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Aldesleukin	DM4YMIS	Acute myelogenous leukaemia	2A41	Approved	[1]
Daclizumab	DM6OZQV	Aplastic anemia	3A70	Approved	[2]

16 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
AIR-insulin	DM8SYTE	Diabetic complication	5A2Y	Phase 3	[3]
TG-4010	DMWE3GB	Bipolar disorder	6A60	Phase 2/3	[4]
APN-301	DM32YTJ	Melanoma	2C30	Phase 2	[5]
BNZ-1	DM8JQZC	Cutaneous T-cell lymphoma	2B01	Phase 2	[6]
Carboxyamidotriazole orotate	DMN5JCX	Glioblastoma multiforme	2A00.0	Phase 2	[7]
Human interleukin-2	DM0NJWG	Renal cell carcinoma	2C90	Phase 2	[8]
IL-2/CD40L-expressing leukemia vaccine	DMIHQ5G	Chronic lymphocytic leukaemia	2A82.0	Phase 2	[9]
L19-IL-2 fusion protein	DMI2XP1	Lymphoma	2A80-2A86	Phase 2	[10]
Leuvectin	DM5LQEI	Melanoma	2C30	Phase 2	[11]
Thymoctonan	DM4BLJM	Immune System disease	4A01-4B41	Phase 2	[12]
IL-2 XL	DM1CG47	Renal cell carcinoma	2C90	Phase 1/2	[13]
IL-2/gene-modified lymphocytes	DMJ9CY4	Ovarian cancer	2C73	Phase 1/2	[14]
Medusa IL-2	DMMB5CV	Solid tumour/cancer	2A00-2F9Z	Phase 1/2	[15]
ASP9801	DMCDMPW	Solid tumour/cancer	2A00-2F9Z	Phase 1	[16]
SAR444245	DM6UN42	Solid tumour/cancer	2A00-2F9Z	Phase 1	[17]
VCL-1M01	DMS9EKG	Melanoma	2C30	Phase 1	[18]

6 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Nuleusin	DMMDY27	Melanoma	2C30	Discontinued in Phase 3	[19]
PMI-001	DMDZBIQ	Lupus	4A40	Discontinued in Phase 3	[20]
BIWB-1	DMQ6CYE	Melanoma	2C30	Discontinued in Phase 2	[21]
VLTS-587	DMOS6CM	Lung cancer	2C25.0	Discontinued in Phase 2	[22]
Roquinimex	DMMK42O	Rheumatoid arthritis	FA20	Discontinued in Phase 1	[23]
TG-1024	DM9KYVQ	Solid tumour/cancer	2A00-2F9Z	Discontinued in Phase 1	[24]

1 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
VPM-4-001	DMZHAVG	Prostate cancer	2C82.0	Preclinical	[25]

6 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
IL-2 antibody (anti-tumor)	DMU6AMP	Discovery agent	N.A.	Investigative	[26]
interleukin-2, Roussel Uclaf	DM3D9XY	Discovery agent	N.A.	Investigative	[27]
SP2456	DM5HUY0	Discovery agent	N.A.	Investigative	[28]
SP4160	DMLA3WY	Discovery agent	N.A.	Investigative	[28]
TG-1031	DM5VJQP	Discovery agent	N.A.	Investigative	[29]
TG-2001	DMRFAVG	Discovery agent	N.A.	Investigative	[30]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Ovarian cancer	2C82	Ovarian tissue	9.48E-01	-0.05	-0.47
Melanoma	2C82	Skin	4.26E-01	-0.07	-0.16
Bipolar disorder	6A20	Pre-frontal cortex	7.64E-01	1.04E-02	0.07
Rheumatoid arthritis	FA20	Synovial tissue	4.71E-01	-0.13	-0.88
Lung cancer	2C82	Lung tissue	3.67E-01	2.69E-03	0.02
Prostate cancer	2C82	Prostate	7.29E-07	0.4	1.2
Renal cancer	2C82	Kidney	5.88E-01	0.13	0.59

References

• [1] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
• [2] 2016 FDA drug approvals. Nat Rev Drug Discov. 2017 Feb 2;16(2):73-76.
• [3] The AIR inhaled insulin system: system components and pharmacokinetic/glucodynamic data. Diabetes Technol Ther. 2007 Jun;9 Suppl 1:S41-7.
• [4] A phase II study of Tg4010 (Mva-Muc1-Il2) in association with chemotherapy in patients with stage III/IV Non-small cell lung cancer. J Thorac Oncol. 2008 Jul;3(7):735-44.
• [5] Clinical pipeline report, company report or official report of APEIRON Biologics.
• [6] Clinical pipeline report, company report or official report of Bioniz Therapeutics.
• [7] J Clin Oncol 32:5s, 2014 (suppl; abstr 2071).
• [8] Clinical pipeline report, company report or official report of Immunservice.
• [9] Immunotherapy of high-risk acute leukemia with a recipient (autologous) vaccine expressing transgenic human CD40L and IL-2 after chemotherapy and a... Blood. 2006 Feb 15;107(4):1332-41.
• [10] National Cancer Institute Drug Dictionary (drug id 665656).
• [11] Intratumoral interleukin 2 for renal-cell carcinoma by direct gene transfer of a plasmid DNA/DMRIE/DOPE lipid complex. World J Urol. 2000 Apr;18(2):152-6.
• [12] Evaluation of efficacy and safety of thymus humoral factor-gamma 2 in the management of chronic hepatitis B. J Hepatol. 1995 Jul;23(1):21-7.
• [13] Pharmacokinetics (PK) and immunologic responses in a phase I/II study of a sustained release formulation of IL-2 in renal cell carcinoma (RCC) patients. J Clin Oncol (Meeting Abstracts) June 2006 vol. 24 no. 18_suppl 2558.
• [14] Genetic modification of human T lymphocytes for the treatment of hematologic malignancies. Haematologica. 2012 November; 97(11): 1622-1631.
• [15] Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.
• [16] Clinical pipeline report, company report or official report of Astellas Pharma.
• [17] Clinical pipeline report, company report or official report of Sanofi.
• [18] Interleukin-2 gene therapy in a patient with glioblastoma. Gene Ther. 1995 Mar;2(2):164-7.
• [19] Expression, purification and characterization of recombinant human interleukin-2-serum albumin (rhIL-2-HSA) fusion protein in Pichia pastoris. Protein Expr Purif. 2012 Jul;84(1):154-60.
• [20] Development of a botanical anti-arthritis drug, PMI-001. SBIR.STTR America's Seed Fund.
• [21] WO patent application no. 2013,1850,32, Nanotherapeutics for drug targeting.
• [22] CN patent application no. 101039956, Cell surface glycoprotein.
• [23] The novel immunomodulator, Linomide, stimulates interleukin-2-induced human natural killer (NK) cell and PHA-stimulated T cell proliferation from normal donors. Leuk Res. 1996 Jan;20(1):57-63.
• [24] Melanoma and Immunotherapy. Hematology/Oncology Clinics of North America Volume 23, Issue 3, June 2009, Pages 547-564.
• [25] BioPartnering North America--Programs from Pharma in Europe and the Middle East. IDrugs. 2010 Mar;13(3):162-5.
• [26] An anti-IL-2 antibody increases serum half-life and improves anti-tumor efficacy of human recombinant interleukin-2. Immunopharmacology. 1994 Nov-Dec;28(3):223-32.
• [27] Randomized study of recombinant interleukin-2 after autologous bone marrow transplantation for acute leukemia in first complete remission. Eur Cytokine Netw. 2000 Mar;11(1):91-8.
• [28] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
• [29] Technology evaluation: TG-1031, Transgene SA.Curr Opin Mol Ther.2000 Feb;2(1):106-11.
• [30] Immunotherapy of metastatic melanoma by intratumoral injections of Vero cells producing human IL-2: phase II randomized study comparing two dose le... Cancer Gene Ther. 2002 Mar;9(3):289-95.